• Gene id: 9775

Gene Summary

• Gene Symbol: EIF4A3   Gene   UCSC   Ensembl
• Aliases: DDX48, Fal1, MUK34, NMP265, NUK34, RCPS, eIF-4A-III, eIF4A-III, eIF4AIII
• Gene name: eukaryotic translation initiation factor 4A3
• Alternate names: eukaryotic initiation factor 4A-III, ATP-dependent RNA helicase DDX48, ATP-dependent RNA helicase eIF4A-3, DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, DEAD box protein 48, NMP 265, eukaryotic initiation factor 4A-like NUK-34, eukaryotic translation initiation fac,
• Gene location: 17q25.3 (80147127: 80134368)     Exons: 12     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA second

Protein Summary

• Protein general information: P38919  
  • Name: Eukaryotic initiation factor 4A III (eIF 4A III) (eIF4A III) (EC 3.6.4.13) (ATP dependent RNA helicase DDX48) (ATP dependent RNA helicase eIF4A 3) (DEAD box protein 48) (Eukaryotic initiation factor 4A like NUK 34) (Eukaryotic translation initiation facto
  • Length: 411  
  • Mass: 46871
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKG
  RDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDI
  RKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEI
  LEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREA
  NFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKG
  VAINFVKNDDIRILRDIEQYYSTQIDEMPMNVADLI

• Structural information:
  • Protein Domains: (69..23-)
    (/note="Helicase-ATP-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00541-)
    (250..41-)
    (/note="Helicase-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00542"-)
  • Interpro: IPR011545  IPR014001  IPR001650  IPR027417  IPR000629   IPR014014  
  • Prosite: PS00039 PS51192 PS51194 PS51195
  • PDB: 2HXY 2HYI 2J0Q 2J0S 2J0U 2XB2 3EX7 4C9B 5MQF 5XJC 5YZG 6ICZ 6QDV
  • PDBsum: 2HXY 2HYI 2J0Q 2J0S 2J0U 2XB2 3EX7 4C9B 5MQF 5XJC 5YZG 6ICZ 6QDV
  • DIP: 33218
  • STRING: ENSP00000269349
• Other Databases: GeneCards:  EIF4A3  Malacards:  EIF4A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003724	RNA helicase activity	IDA	molecular function
GO:0008143	poly(A) binding	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0017148	negative regulation of translation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0071013	catalytic step 2 spliceosome	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0003724	RNA helicase activity	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0071013	catalytic step 2 spliceosome	IDA	cellular component
GO:0035145	exon-exon junction complex	IDA	cellular component
GO:0003729	mRNA binding	IDA	molecular function
GO:0000398	mRNA splicing, via spliceosome	IC	biological process
GO:0000398	mRNA splicing, via spliceosome	IDA	biological process
GO:0071006	U2-type catalytic step 1 spliceosome	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0048701	embryonic cranial skeleton morphogenesis	IMP	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004386	helicase activity	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005681	spliceosomal complex	IEA	cellular component
GO:0051028	mRNA transport	IEA	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0003724	RNA helicase activity	IEA	molecular function
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0035613	RNA stem-loop binding	IEA	molecular function
GO:0072715	cellular response to selenite ion	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099578	regulation of translation at postsynapse, modulating synaptic transmission	IEA	biological process
GO:1904574	negative regulation of selenocysteine insertion sequence binding	IEA	biological process
GO:1990416	cellular response to brain-derived neurotrophic factor stimulus	IEA	biological process
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008306	associative learning	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0035368	selenocysteine insertion sequence binding	IEA	molecular function
GO:0035640	exploration behavior	IEA	biological process
GO:0043021	ribonucleoprotein complex binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0045182	translation regulator activity	IEA	molecular function
GO:0090394	negative regulation of excitatory postsynaptic potential	IEA	biological process
GO:0099524	postsynaptic cytosol	IEA	cellular component
GO:1902415	regulation of mRNA binding	IEA	biological process
GO:1904570	negative regulation of selenocysteine incorporation	IEA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0045727	positive regulation of translation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa03040	Spliceosome
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Intellectual disability	PMID:23376982
pancreatic cancer	PMID:15796914
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq