• Gene id: 9770

Gene Summary

• Gene Symbol: RASSF2   Gene   UCSC   Ensembl
• Aliases: CENP-34, RASFADIN
• Gene name: Ras association domain family member 2
• Alternate names: ras association domain-containing protein 2, Ras association (RalGDS/AF-6) domain family 2, Ras association (RalGDS/AF-6) domain family member 2, centromere protein 34,
• Gene location: 20p13 (4823667: 4780022)     Exons: 15     NC_000020.11
• Gene summary(Entrez): This gene encodes a protein that contains a Ras association domain. Similar to its cattle and sheep counterparts, this gene is located near the prion gene. Two alternatively spliced transcripts encoding the same isoform have been reported. [provided by Re
• OMIM: 609492

Protein Summary

• Protein general information: P50749  
  • Name: Ras association domain containing protein 2
  • Length: 326  
  • Mass: 37790
  • Tissue specificity: Widely expressed with highest levels in brain, placenta, peripheral blood and lung. Frequently down-regulated in lung tumor cell lines. {ECO
• Sequence:

  MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISWGLRRPIRLQMQDDNE
  RIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQMPSSTDSRGLKPLQEDTPQLMRTRSDVGVR
  RRGNVRTPSDQRRIRRHRFSINGHFYNHKTSVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYV
  VHTSGEKQKLKATDYPLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK
  LMRKYTVLRLMIRQRLEEIAETPATI

• Structural information:
  • Protein Domains: (176..26-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00166-)
    (272..31-)
    (/note="SARAH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00310"-)
  • Interpro: IPR033614  IPR000159  IPR033618  IPR011524  IPR029071  
  • Prosite: PS50200 PS50951
  • STRING: ENSP00000368710
• Other Databases: GeneCards:  RASSF2  Malacards:  RASSF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000776	kinetochore	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031954	positive regulation of protein autophosphorylation	IDA	biological process
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0045860	positive regulation of protein kinase activity	IDA	biological process
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0004672	protein kinase activity	IGI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IEA	biological process
GO:1901222	regulation of NIK/NF-kappaB signaling	IEA	biological process
GO:0048872	homeostasis of number of cells	IEA	biological process
GO:0046849	bone remodeling	IEA	biological process
GO:0045670	regulation of osteoclast differentiation	IEA	biological process
GO:0038168	epidermal growth factor receptor signaling pathway via I-kappaB kinase/NF-kappaB cascade	IEA	biological process
GO:0001503	ossification	IEA	biological process
GO:0001501	skeletal system development	IEA	biological process
GO:0045667	regulation of osteoblast differentiation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0050821	protein stabilization	IMP	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04392	Hippo signaling pathway - multiple species

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray