• Gene id: 977

Gene Summary

• Gene Symbol: CD151   Gene   UCSC   Ensembl
• Aliases: GP27, MER2, PETA-3, RAPH, SFA1, TSPAN24
• Gene name: CD151 molecule (Raph blood group)
• Alternate names: CD151 antigen, CD151 antigen (Raph blood group), hemidesmosomal tetraspanin CD151, membrane glycoprotein SFA-1, platelet surface glycoprotein gp27, platelet-endothelial cell tetraspan antigen 3, platelet-endothelial tetraspan antigen 3, tetraspanin-24, tspan-24,
• Gene location: 11p15.5 (832951: 838834)     Exons: 10     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 602243

Protein Summary

• Protein general information: P48509  
  • Name: CD151 antigen (GP27) (Membrane glycoprotein SFA 1) (Platelet endothelial tetraspan antigen 3) (PETA 3) (Tetraspanin 24) (Tspan 24) (CD antigen CD151)
  • Length: 253  
  • Mass: 28295
  • Tissue specificity: Expressed in a variety of tissues including vascular endothelium and epidermis. Expressed on erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes. {ECO
• Sequence:

  MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLATAYILVVAGTVVMVTG
  VLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQ
  QEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGA
  VGIGIACVQVFGMIFTCCLYRSLKLEHY

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000380565
• Other Databases: GeneCards:  CD151  Malacards:  CD151

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005604	basement membrane	IDA	cellular component
GO:0016477	cell migration	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0045807	positive regulation of endocytosis	IDA	biological process
GO:0044319	wound healing, spreading of cells	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0005178	integrin binding	IDA	molecular function
GO:0045807	positive regulation of endocytosis	IMP	biological process
GO:0044319	wound healing, spreading of cells	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0031581	hemidesmosome assembly	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042098	T cell proliferation	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005178	integrin binding	IDA	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Nephropathy with pretibial epidermolysis bullosa and deafness	KEGG:H00928
Nephropathy with pretibial epidermolysis bullosa and deafness	KEGG:H00928
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq