• Gene id: 9768

Gene Summary

• Gene Symbol: PCLAF   Gene   UCSC   Ensembl
• Aliases: KIAA0101, L5, NS5ATP9, OEATC, OEATC-1, OEATC1, PAF, PAF15, p15(PAF), p15/PAF, p15PAF
• Gene name: PCNA clamp associated factor
• Alternate names: PCNA-associated factor, HCV NS5A-transactivated protein 9, PCNA-associated factor of 15 kDa, hepatitis C virus NS5A-transactivated protein 9, overexpressed in anaplastic thyroid carcinoma 1,
• Gene location: 15q22.31 (64387686: 64364993)     Exons: 5     NC_000015.10
• OMIM: 610696

Protein Summary

• Protein general information: Q15004  
  • Name: PCNA associated factor (Hepatitis C virus NS5A transactivated protein 9) (HCV NS5A transactivated protein 9) (Overexpressed in anaplastic thyroid carcinoma 1) (OEATC 1) (PCNA associated factor of 15 kDa) (PAF15) (p15PAF) (PCNA clamp associated factor)
  • Length: 111  
  • Mass: 11,986
• Sequence:

  MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKD
  SEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

• Structural information:
  • Interpro: IPR031444  
  • PDB: 4D2G
  • PDBsum: 4D2G
  • STRING: ENSP00000300035
• Other Databases: GeneCards:  PCLAF  Malacards:  PCLAF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006260	DNA replication	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0019985	translesion synthesis	IMP	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051297	centrosome organization	IMP	biological process
GO:0051726	regulation of cell cycle	IMP	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006260	DNA replication	IDA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0019985	translesion synthesis	IMP	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051297	centrosome organization	IMP	biological process
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051726	regulation of cell cycle	IMP	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006260	DNA replication	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0009411	response to UV	IDA	biological process
GO:0019985	translesion synthesis	IMP	biological process
GO:0019985	translesion synthesis	TAS	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0051297	centrosome organization	IMP	biological process
GO:0051726	regulation of cell cycle	IMP	biological process

Diseases

Associated diseases	References
Polycystic ovary syndrome (PCOS)	INFBASE: 22197603
Sperm motility	MIK: 23209346
Male subfertility	MIK: 2070861
Leukocytospermia	MIK: 23209346
Leukocytospermia	MIK: 23209346
Sperm motility defects	MIK: 23209346
Male subfertility	MIK: 2070861
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23209346	Leukocytospermia, sperm motility			37 (22 cases of leukocytospermia, 15 cases of normal males)	Male infertility	PAF TNF-?
2070861	Male subfertility			14 (6 randomly chosen normal donors, 8 asthenozoospermic patients)	Male infertility	PAF
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)