• Gene id: 9767

Gene Summary

• Gene Symbol: JADE3   Gene   UCSC   Ensembl
• Aliases: JADE-3, PHF16
• Gene name: jade family PHD finger 3
• Alternate names: protein Jade-3, PHD finger protein 16, jade family PHD finger protein 3,
• Gene location: Xp11.3 (46912275: 47061241)     Exons: 12     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of a family of large proteins containing PHD (plant homeo domain)-type zinc fingers. The encoded protein may be associated in a nuclear complex that functions in histone H4 acetylation. Alternative splicing results in multiple t
• OMIM: 300618

Protein Summary

• Protein general information: Q92613  
  • Name: Protein Jade 3 (Jade family PHD finger protein 3) (PHD finger protein 16)
  • Length: 823  
  • Mass: 93808
  • Tissue specificity: Ubiquitously expressed, with highest levels in placenta and uterus. {ECO
• Sequence:

  MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLISAMKLPDSHHINPDSYYLFADTWKEE
  WEKGVQVPASPDTVPQPSLRIIAEKVKDVLFIRPRKYIHCSSPDTTEPGYINIMELAASVCRYDLDDMDIFWLQE
  LNEDLAEMGCGPVDENLMEKTVEVLERHCHENMNHAIETEEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNV
  CVHQACYGILKVPEGSWLCRSCVLGIYPQCVLCPKKGGALKTTKTGTKWAHVSCALWIPEVSIACPERMEPITKI
  SHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKSYCLKHSQNRQKLGEA
  EYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFYSLVRVEDVAAELGMPTLAVDFIYNYWKLKRKSNFNKPLFPPK
  EDEENGLVQPKEESIHTRMRMFMHLRQDLERVRNLCYMISRREKLKLSHNKIQEQIFGLQVQLLNQEIDAGLPLT
  NALENSLFYPPPRITLKLKMPKSTPEDHRNSSTETDQQPHSPDSSSSVHSIRNMQVPQESLEMRTKSYPRYPLES
  KNNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSLGKPLVLQAALHGQSSIGNGKSQPNSKFAKSNGLEGSWSG
  NVTQKDSSSEMFCDQEPVFSPHLVSQGSFRKSTVEHFSRSFKETTNRWVKNTEDLQCYVKPTKNMSPKEQFWGRQ
  VLRRSAGRAPYQENDGYCPDLELSDSEAESDGNKEKVRVRKDSSDRENPPHDSRRDCHGKSKTHPLSHSSMQR

• Structural information:
  • Interpro: IPR019542  IPR034732  IPR039550  IPR019786  IPR011011   IPR001965  IPR019787  IPR013083  
  • Prosite: PS51805 PS01359 PS50016
  • CDD: cd15681
  • STRING: ENSP00000481850
• Other Databases: GeneCards:  JADE3  Malacards:  JADE3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043981	histone H4-K5 acetylation	IDA	biological process
GO:0043984	histone H4-K16 acetylation	IDA	NOT|biological process
GO:0043982	histone H4-K8 acetylation	IDA	biological process
GO:0043966	histone H3 acetylation	IDA	biological process
GO:0000123	histone acetyltransferase complex	IDA	cellular component
GO:0043983	histone H4-K12 acetylation	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881