• Gene id: 9766

Gene Summary

• Gene Symbol: SUSD6   Gene   UCSC   Ensembl
• Aliases: DRAGO, KIAA0247
• Gene name: sushi domain containing 6
• Alternate names: sushi domain-containing protein 6, drug-activated gene overexpressed protein,
• Gene location: 14q24.1 (69611595: 69715143)     Exons: 13     NC_000014.9
• OMIM: 616761

Protein Summary

• Protein general information: Q92537  
  • Name: Sushi domain containing protein 6 (Drug activated gene overexpressed protein)
  • Length: 303  
  • Mass: 32090
• Sequence:

  MCHGRIAPKSTSVFAVASVGHGVFLPLVILCTLLGDGLASVCPLPPEPENGGYICHPRPCRDPLTAGSVIEYLCA
  EGYMLKGDYKYLTCKNGEWKPAMEISCRLNEDKDTHTSLGVPTLSIVASTASSVALILLLVVLFVLLQPKLKSFH
  HSRRDQGVSGDQVSIMVDGVQVALPSYEEAVYGSSGHCVPPADPRVQIVLSEGSGPSGRSVPREQQLPDQGACSS
  AGGEDEAPGQSGLCEAWGSRASETVMVHQATTSSWVAGSGNRQLAHKETADSENSDIQSLLSLTSEEYTDDIPLL
  KEA

• Structural information:
  • Protein Domains: (40..10-)
    (/note="Sushi-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302"-)
  • Interpro: IPR042866  IPR035976  IPR000436  
  • Prosite: PS50923
  • CDD: cd00033
  • STRING: ENSP00000344424
• Other Databases: GeneCards:  SUSD6  Malacards:  SUSD6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008219	cell death	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray