• Gene id: 975

Gene Summary

• Gene Symbol: CD81   Gene   UCSC   Ensembl
• Aliases: CVID6, S5.7, TAPA1, TSPAN28
• Gene name: CD81 molecule
• Alternate names: CD81 antigen, 26 kDa cell surface protein TAPA-1, CD81 antigen (target of antiproliferative antibody 1), tetraspanin-28, tspan-28,
• Gene location: 11p15.5 (2376176: 2397418)     Exons: 10     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 186845

Protein Summary

• Protein general information: P60033  
  • Name: CD81 antigen (26 kDa cell surface protein TAPA 1) (Target of the antiproliferative antibody 1) (Tetraspanin 28) (Tspan 28) (CD antigen CD81)
  • Length: 236  
  • Mass: 25809
  • Tissue specificity: Expressed on B cells (at protein level) (PubMed
• Sequence:

  MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFV
  GFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTF
  HETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMV
  LCCGIRNSSVY

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • PDB: 1G8Q 1IV5 2AVZ 3X0E 5DFV 5DFW 5M2C 5M33 5M3D 5M3T 5M4R 5TCX 6EJG 6EJM 6EK2
  • PDBsum: 1G8Q 1IV5 2AVZ 3X0E 5DFV 5DFW 5M2C 5M33 5M3D 5M3T 5M4R 5TCX 6EJG 6EJM 6EK2
  • STRING: ENSP00000263645
• Other Databases: GeneCards:  CD81  Malacards:  CD81

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:2000563	positive regulation of CD4-positive, alpha-beta T cell proliferation	IDA	biological process
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:2001190	positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IDA	biological process
GO:0001772	immunological synapse	IDA	cellular component
GO:0097197	tetraspanin-enriched microdomain	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0035783	CD4-positive, alpha-beta T cell costimulation	IDA	biological process
GO:0005178	integrin binding	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0015485	cholesterol binding	IDA	molecular function
GO:0034238	macrophage fusion	IDA	biological process
GO:2000553	positive regulation of T-helper 2 cell cytokine production	IDA	biological process
GO:1903911	positive regulation of receptor clustering	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0042289	MHC class II protein binding	IDA	molecular function
GO:0071404	cellular response to low-density lipoprotein particle stimulus	ISS	biological process
GO:0001618	virus receptor activity	IMP	molecular function
GO:1905676	positive regulation of adaptive immune memory response	IMP	biological process
GO:0072659	protein localization to plasma membrane	IMP	biological process
GO:0072675	osteoclast fusion	ISS	biological process
GO:0050862	positive regulation of T cell receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031623	receptor internalization	ISS	biological process
GO:0050861	positive regulation of B cell receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002455	humoral immune response mediated by circulating immunoglobulin	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001771	immunological synapse formation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0014905	myoblast fusion involved in skeletal muscle regeneration	ISS	biological process
GO:0050861	positive regulation of B cell receptor signaling pathway	ISS	biological process
GO:1905521	regulation of macrophage migration	ISS	biological process
GO:1905521	regulation of macrophage migration	ISS	biological process
GO:0002863	positive regulation of inflammatory response to antigenic stimulus	ISS	biological process
GO:0070863	positive regulation of protein exit from endoplasmic reticulum	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0001618	virus receptor activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030890	positive regulation of B cell proliferation	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030449	regulation of complement activation	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001190	positive regulation of T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IEA	biological process
GO:2000145	regulation of cell motility	IEA	biological process
GO:0072675	osteoclast fusion	IEA	biological process
GO:0071404	cellular response to low-density lipoprotein particle stimulus	IEA	biological process
GO:2000553	positive regulation of T-helper 2 cell cytokine production	IEA	biological process
GO:1905521	regulation of macrophage migration	IEA	biological process
GO:1903911	positive regulation of receptor clustering	IEA	biological process
GO:0050871	positive regulation of B cell activation	IEA	biological process
GO:0050861	positive regulation of B cell receptor signaling pathway	IEA	biological process
GO:0034238	macrophage fusion	IEA	biological process
GO:0031623	receptor internalization	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0014905	myoblast fusion involved in skeletal muscle regeneration	IEA	biological process
GO:0002863	positive regulation of inflammatory response to antigenic stimulus	IEA	biological process
GO:1904352	positive regulation of protein catabolic process in the vacuole	IMP	biological process
GO:0061462	protein localization to lysosome	IMP	biological process
GO:1990459	transferrin receptor binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0031647	regulation of protein stability	IMP	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0008104	protein localization	IDA	biological process
GO:0043128	positive regulation of 1-phosphatidylinositol 4-kinase activity	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005178	integrin binding	IDA	molecular function
GO:0023026	MHC class II protein complex binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0046813	receptor-mediated virion attachment to host cell	TAS	biological process
GO:0046718	viral entry into host cell	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05160	Hepatitis C
hsa04662	B cell receptor signaling pathway
hsa05144	Malaria

Diseases

Associated diseases	References
Common variable immunodeficiency	KEGG:H00088
Common variable immunodeficiency	KEGG:H00088
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq