• Gene id: 9747

Gene Summary

• Gene Symbol: TCAF1   Gene   UCSC   Ensembl
• Aliases: FAM115A
• Gene name: TRPM8 channel associated factor 1
• Alternate names: TRPM8 channel-associated factor 1, TRP channel-associated factor 1, family with sequence similarity 115, member A, protein FAM115A,
• Gene location: 7q35 (143902197: 143851374)     Exons: 12     NC_000007.14
• OMIM: 611339

Protein Summary

• Protein general information: Q9Y4C2  
  • Name: TRPM8 channel associated factor 1 (TRP channel associated factor 1)
  • Length: 921  
  • Mass: 102126
  • Tissue specificity: Isoform 2 is expressed in the prostate and strongly expressed in cancerous prostate samples. {ECO
• Sequence:

  MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLVVVSHEDYLVEAQLTP
  FLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKDSLGVYCIDAYNETMTEKLVKFMKCGGGLLI
  GGQAWDWANQGEDERVLFTFPGNLVTSVAGIYFTDNKGDTSFFKVSKKMPKIPVLVSCEDDLSDDREELLHGISE
  LDISNSDCFPSQLLVHGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVGKLGPFLLNAVRWLDGGRRGK
  VVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEFVAEGGGLFVGAQAWWWAFKNPGVSP
  LARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAEFQVIMGRKRGNVEKGWLAKLGPDGAAFLQI
  PAEEIPAYMSVHRLLRKLLSRYRLPVATRENPVINDCCRGAMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPS
  ESPITVEVNCTNPGTRYCWMSTGLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLD
  KPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPT
  ANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTK
  GLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWN
  AWTALETYLQLQEAFGWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSL
  AYLPEWKENIMKLYLLTQMPH

• Structural information:
  • Protein Domains: (542..84-)
    (/note="Peptidase-M60)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01060"-)
  • Interpro: IPR029062  IPR035423  IPR042279  IPR031161  
  • Prosite: PS51723
  • STRING: ENSP00000419235
• Other Databases: GeneCards:  TCAF1  Malacards:  TCAF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901529	positive regulation of anion channel activity	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:0010359	regulation of anion channel activity	IBA	biological process
GO:0090314	positive regulation of protein targeting to membrane	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:1901529	positive regulation of anion channel activity	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0090314	positive regulation of protein targeting to membrane	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0044325	ion channel binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:1901529	positive regulation of anion channel activity	IBA	biological process
GO:0044325	ion channel binding	IBA	molecular function
GO:0010359	regulation of anion channel activity	IBA	biological process
GO:0090314	positive regulation of protein targeting to membrane	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:1901529	positive regulation of anion channel activity	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0044325	ion channel binding	IPI	molecular function
GO:0090314	positive regulation of protein targeting to membrane	IMP	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0044325	ion channel binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R