• Gene id: 9746

Gene Summary

• Gene Symbol: CLSTN3   Gene   UCSC   Ensembl
• Aliases: CDHR14, CSTN3, alcbeta
• Gene name: calsyntenin 3
• Alternate names: calsyntenin-3, alc-beta, alcadein beta, cadherin-related family member 14,
• Gene location: 12p13.31 (7130370: 7158944)     Exons: 18     NC_000012.12
• OMIM: 605963

Protein Summary

• Protein general information: Q9BQT9  
  • Name: Calsyntenin 3 (Alcadein beta) (Alc beta)
  • Length: 956  
  • Mass: 106098
  • Tissue specificity: According to PubMed
• Sequence:

  MTLLLLPLLLASLLASCSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLRYAGEICGFRLHGSGV
  PFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDGANTKKSHKATVHVRVNDVNEFAPVFVERLY
  RAAVTEGKLYDRILRVEAIDGDCSPQYSQICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGK
  KRAADDAEVEIQVKPTCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNY
  SERALRKLCGAATGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGPSGLGSGPQDSLSDHFT
  LSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQVCDDEWHHY
  ALNLEFPTVTLYTDGISFDPALIHDNGLIHPPRREPALMIGACWTEEKNKEKEKGDNSTDTTQGDPLSIHHYFHG
  YLAGFSVRSGRLESREVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTLR
  FATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFEGTNGVPLFPDLQITCS
  ISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDPERESLLLDTTSLQQRGLELTNTSAYLTIAGV
  ESITVYEEILRQARYRLRHGAALYTRKFRLSCSEMNGRYSSNEFIVEVNVLHSMNRVAHPSHVLSSQQFLHRGHQ
  PPPEMAGHSLASSHRNSMIPSAATLIIVVCVGFLVLMVVLGLVRIHSLHRRVSGAGGPPGASSDPKDPDLFWDDS
  ALTIIVNPMESYQNRQSCVTGAVGGQQEDEDSSDSEVADSPSSDERRIIETPPHRY

• Structural information:
  • Protein Domains: (29..14-)
    (/note="Cadherin-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043-)
    (146..24-)
    (/note="Cadherin-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00043"-)
  • Interpro: IPR002126  IPR015919  IPR026914  IPR013320  
  • Prosite: PS50268
  • STRING: ENSP00000266546
• Other Databases: GeneCards:  CLSTN3  Malacards:  CLSTN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050806	positive regulation of synaptic transmission	IBA	biological process
GO:0051965	positive regulation of synapse assembly	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0005509	calcium ion binding	IEA	molecular function
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001558	regulation of cell growth	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0035249	synaptic transmission, glutamatergic	IEA	biological process
GO:0050806	positive regulation of synaptic transmission	IEA	biological process
GO:0051932	synaptic transmission, GABAergic	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:1902474	positive regulation of protein localization to synapse	IEA	biological process
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0007416	synapse assembly	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0098794	postsynapse	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray