• Gene id: 974

Gene Summary

• Gene Symbol: CD79B   Gene   UCSC   Ensembl
• Aliases: AGM6, B29, IGB
• Gene name: CD79b molecule
• Alternate names: B-cell antigen receptor complex-associated protein beta chain, B-cell-specific glycoprotein B29, CD79b antigen (immunoglobulin-associated beta), CD79b molecule, immunoglobulin-associated beta, Ig-beta, immunoglobulin-associated B29 protein,
• Gene location: 17q23.3 (63932330: 63928739)     Exons: 6     NC_000017.11
• Gene summary(Entrez): The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and
• OMIM: 147245

Protein Summary

• Protein general information: P40259  
  • Name: B cell antigen receptor complex associated protein beta chain (B cell specific glycoprotein B29) (Ig beta) (Immunoglobulin associated B29 protein) (CD antigen CD79b)
  • Length: 229  
  • Mass: 26048
  • Tissue specificity: B-cells.
• Sequence:

  MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVS
  WLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQ
  LKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEH
  PGQE

• Structural information:
  • Protein Domains: (38..13-)
    (/note="Ig-like-V-type)
    (185..21-)
    (/note="ITAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00379"-)
  • Interpro: IPR039695  IPR007110  IPR036179  IPR013783  IPR003599   IPR013106  IPR003110  
  • Prosite: PS50835 PS51055
  • PDB: 3KG5
  • PDBsum: 3KG5
  • DIP: 59497
  • STRING: ENSP00000376544
• Other Databases: GeneCards:  CD79B  Malacards:  CD79B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050853	B cell receptor signaling pathway	IBA	biological process
GO:0030183	B cell differentiation	IBA	biological process
GO:0019815	B cell receptor complex	IBA	cellular component
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0019815	B cell receptor complex	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0009617	response to bacterium	IEA	biological process
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0019815	B cell receptor complex	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04662	B cell receptor signaling pathway

Diseases

Associated diseases	References
Agammaglobulinemias	KEGG:H00085
Primary central nervous system lymphoma	KEGG:H02424
Agammaglobulinemias	KEGG:H00085
Primary central nervous system lymphoma	KEGG:H02424
mantle cell lymphoma	PMID:10329919
splenic marginal zone lymphoma	PMID:10329919
acute lymphocytic leukemia	PMID:21487112
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881