• Gene id: 9730

Gene Summary

• Gene Symbol: DCAF1   Gene   UCSC   Ensembl
• Aliases: RIP, VPRBP
• Gene name: DDB1 and CUL4 associated factor 1
• Alternate names: DDB1- and CUL4-associated factor 1, HIV-1 Vpr-binding protein, Vpr (HIV-1) binding protein, Vpr-binding protein, protein VPRBP, serine/threonine-protein kinase VPRBP, vpr-interacting protein,
• Gene location: 3p21.2 (49065075: 49058283)     Exons: 7     NC_000019.10
• OMIM: 617259

Protein Summary

• Protein general information: Q9Y4B6  
  • Name: DDB1 and CUL4 associated factor 1 (HIV 1 Vpr binding protein) (VprBP) (Serine/threonine protein kinase VPRBP) (EC 2.7.11.1) (Vpr interacting protein)
  • Length: 1507  
  • Mass: 169007
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MTTVVVHVDSKAELTTLLEQWEKEHGSGQDMVPILTRMSQLIEKETEEYRKGDPDPFDDRHPGRADPECMLGHLL
  RILFKNDDFMNALVNAYVMTSREPPLNTAACRLLLDIMPGLETAVVFQEKEGIVENLFKWAREADQPLRTYSTGL
  LGGAMENQDIAANYRDENSQLVAIVLRRLRELQLQEVALRQENKRPSPRKLSSEPLLPLDEEAVDMDYGDMAVDV
  VDGDQEEASGDMEISFHLDSGHKTSSRVNSTTKPEDGGLKKNKSAKQGDRENFRKAKQKLGFSSSDPDRMFVELS
  NSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQLGSRELMMFYIDLKQTNDVLLTFEAL
  KHLASLLLHNKFATEFVAHGGVQKLLEIPRPSMAATGVSMCLYYLSYNQDAMERVCMHPHNVLSDVVNYTLWLME
  CSHASGCCHATMFFSICFSFRAVLELFDRYDGLRRLVNLISTLEILNLEDQGALLSDDEIFASRQTGKHTCMALR
  KYFEAHLAIKLEQVKQSLQRTEGGILVHPQPPYKACSYTHEQIVEMMEFLIEYGPAQLYWEPAEVFLKLSCVQLL
  LQLISIACNWKTYYARNDTVRFALDVLAILTVVPKIQLQLAESVDVLDEAGSTVSTVGISIILGVAEGEFFIHDA
  EIQKSALQIIINCVCGPDNRISSIGKFISGTPRRKLPQNPKSSEHTLAKMWNVVQSNNGIKVLLSLLSIKMPITD
  ADQIRALACKALVGLSRSSTVRQIISKLPLFSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSGKPLLIGT
  DVSLARLQKADVVAQSRISFPEKELLLLIRNHLISKGLGETATVLTKEADLPMTAASHSSAFTPVTAAASPVSLP
  RTPRIANGIATRLGSHAAVGASAPSAPTAHPQPRPPQGPLALPGPSYAGNSPLIGRISFIRERPSPCNGRKIRVL
  RQKSDHGAYSQSPAIKKQLDRHLPSPPTLDSIITEYLREQHARCKNPVATCPPFSLFTPHQCPEPKQRRQAPINF
  TSRLNRRASFPKYGGVDGGCFDRHLIFSRFRPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLYNVFSG
  QEEASYNCHNSAITHLEPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYVEFSKHSQDRVIGTKGDIA
  HIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNMNISGVFHPNGLEVII
  NTEIWDLRTFHLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDDLMEERMKSPFGSSFRTFNATDYKPIATIDV
  KRNIFDLCTDTKDCYLAVIENQGSMDALNMDTVCRLYEVGRQRLAEDEDEEEDQEEEEQEEEDDDEDDDDTDDLD
  ELDTDQLLEAELEEDDNNENAGEDGDNDFSPSDEELANLLEEGEDGEDEDSDADEEVELILGDTDSSDNSDLEDD
  IILSLNE

• Structural information:
  • Protein Domains: (562..59-)
    (/note="Chromo-)
    (846..87-)
    (/note="LisH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00126"-)
  • Interpro: IPR016024  IPR006594  IPR033270  IPR015943  IPR036322  
  • Prosite: PS50896
  • PDB: 3WA0 4CC9 4P7I 4PXW 4Z8L 5AJA 5JK7 6N45
  • PDBsum: 3WA0 4CC9 4P7I 4PXW 4Z8L 5AJA 5JK7 6N45
  • DIP: 47048
  • STRING: ENSP00000393183
• Other Databases: GeneCards:  DCAF1  Malacards:  DCAF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0030331	estrogen receptor binding	IBA	molecular function
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IBA	cellular component
GO:1990244	histone kinase activity (H2A-T120 specific)	IBA	molecular function
GO:1990245	histone H2A-T120 phosphorylation	IBA	biological process
GO:1990245	histone H2A-T120 phosphorylation	IDA	biological process
GO:0008180	COP9 signalosome	IDA	colocalizes with
GO:1990244	histone kinase activity (H2A-T120 specific)	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0033151	V(D)J recombination	ISS	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0035212	cell competition in a multicellular organism	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030331	estrogen receptor binding	IPI	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0033151	V(D)J recombination	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0080008	Cul4-RING E3 ubiquitin ligase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05170	Human immunodeficiency virus 1 infection

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R