• Gene id: 9727

Gene Summary

• Gene Symbol: RAB11FIP3   Gene   UCSC   Ensembl
• Aliases: CART1, FIP3-Rab11, Rab11-FIP3
• Gene name: RAB11 family interacting protein 3
• Alternate names: rab11 family-interacting protein 3, EF hands-containing Rab-interacting protein, MU-MB-17.148, RAB11 family interacting protein 3 (class II), arfophilin-1, cytoplasmic adaptor for RAR and TR, eferin,
• Gene location: 16p13.3 (425620: 523010)     Exons: 19     NC_000016.10
• Gene summary(Entrez): Proteins of the large Rab GTPase family (see RAB1A; MIM 179508) have regulatory roles in the formation, targeting, and fusion of intracellular transport vesicles. RAB11FIP3 is one of many proteins that interact with and regulate Rab GTPases (Hales et al.,
• OMIM: 616690

Protein Summary

• Protein general information: O75154  
  • Name: Rab11 family interacting protein 3 (FIP3 Rab11) (Rab11 FIP3) (Arfophilin 1) (EF hands containing Rab interacting protein) (Eferin) (MU MB 17.148)
  • Length: 756  
  • Mass: 82440
• Sequence:

  MASAPPASPPGSEPPGPDPEPGGPDGPGAAQLAPGPAELRLGAPVGGPDPQSPGLDEPAPGAAADGGARWSAGPA
  PGLEGGPRDPGPSAPPPRSGPRGQLASPDAPGPGPRSEAPLPELDPLFSWTEEPEECGPASCPESAPFRLQGSSS
  SHRARGEVDVFSPFPAPTAGELALEQGPGSPPQPSDLSQTHPLPSEPVGSQEDGPRLRAVFDALDGDGDGFVRIE
  DFIQFATVYGAEQVKDLTKYLDPSGLGVISFEDFYQGITAIRNGDPDGQCYGGVASAQDEEPLACPDEFDDFVTY
  EANEVTDSAYMGSESTYSECETFTDEDTSTLVHPELQPEGDADSAGGSAVPSECLDAMEEPDHGALLLLPGRPHP
  HGQSVITVIGGEEHFEDYGEGSEAELSPETLCNGQLGCSDPAFLTPSPTKRLSSKKVARYLHQSGALTMEALEDP
  SPELMEGPEEDIADKVVFLERRVLELEKDTAATGEQHSRLRQENLQLVHRANALEEQLKEQELRACEMVLEETRR
  QKELLCKMEREKSIEIENLQTRLQQLDEENSELRSCTPCLKANIERLEEEKQKLLDEIESLTLRLSEEQENKRRM
  GDRLSHERHQFQRDKEATQELIEDLRKQLEHLQLLKLEAEQRRGRSSSMGLQEYHSRARESELEQEVRRLKQDNR
  NLKEQNEELNGQIITLSIQGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNP
  SILEVK

• Structural information:
  • Protein Domains: (202..23-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (234..26-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (694..75-)
    (/note="FIP-RBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0-)
  • Interpro: IPR011992  IPR002048  IPR037245  IPR019018  IPR032920  
  • Prosite: PS50222 PS51511
  • PDB: 2D7C 2HV8 4D0M 4UJ3 4UJ4
  • PDBsum: 2D7C 2HV8 4D0M 4UJ3 4UJ4
  • DIP: 47494
  • STRING: ENSP00000262305
• Other Databases: GeneCards:  RAB11FIP3  Malacards:  RAB11FIP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070164	negative regulation of adiponectin secretion	IDA	biological process
GO:0055038	recycling endosome membrane	IBA	cellular component
GO:0032456	endocytic recycling	IBA	biological process
GO:0030306	ADP-ribosylation factor binding	IBA	molecular function
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0032465	regulation of cytokinesis	IBA	biological process
GO:0032154	cleavage furrow	IBA	cellular component
GO:0030496	midbody	IBA	cellular component
GO:0030139	endocytic vesicle	IBA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0032456	endocytic recycling	IDA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:0032154	cleavage furrow	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:0030306	ADP-ribosylation factor binding	IPI	molecular function
GO:0030306	ADP-ribosylation factor binding	IPI	molecular function
GO:0030306	ADP-ribosylation factor binding	IPI	molecular function
GO:0030306	ADP-ribosylation factor binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IPI	molecular function
GO:0016192	vesicle-mediated transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0032465	regulation of cytokinesis	IMP	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0030306	ADP-ribosylation factor binding	IEA	molecular function
GO:0032456	endocytic recycling	IEA	biological process
GO:0032465	regulation of cytokinesis	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0051959	dynein light intermediate chain binding	IPI	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0061512	protein localization to cilium	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0032154	cleavage furrow	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0017137	Rab GTPase binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R