• Gene id: 9706

Gene Summary

• Gene Symbol: ULK2   Gene   UCSC   Ensembl
• Aliases: ATG1B, Unc51.2
• Gene name: unc-51 like autophagy activating kinase 2
• Alternate names: serine/threonine-protein kinase ULK2,
• Gene location: 17p11.2 (19867935: 19770827)     Exons: 29     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein that is similar to a serine/threonine kinase in C. elegans which is involved in axonal elongation. The structure of this protein is similar to the C. elegans protein in that both proteins have an N-terminal kinase domain, a cen
• OMIM: 608650

Protein Summary

• Protein general information: Q8IYT8  
  • Name: Serine/threonine protein kinase ULK2 (EC 2.7.11.1) (Unc 51 like kinase 2)
  • Length: 1036  
  • Mass: 112694
• Sequence:

  MEVVGDFEYSKRDLVGHGAFAVVFRGRHRQKTDWEVAIKSINKKNLSKSQILLGKEIKILKELQHENIVALYDVQ
  ELPNSVFLVMEYCNGGDLADYLQAKGTLSEDTIRVFLHQIAAAMRILHSKGIIHRDLKPQNILLSYANRRKSSVS
  GIRIKIADFGFARYLHSNMMAATLCGSPMYMAPEVIMSQHYDAKADLWSIGTVIYQCLVGKPPFQANSPQDLRMF
  YEKNRSLMPSIPRETSPYLANLLLGLLQRNQKDRMDFEAFFSHPFLEQGPVKKSCPVPVPMYSGSVSGSSCGSSP
  SCRFASPPSLPDMQHIQEENLSSPPLGPPNYLQVSKDSASTSSKNSSCDTDDFVLVPHNISSDHSCDMPVGTAGR
  RASNEFLVCGGQCQPTVSPHSETAPIPVPTQIRNYQRIEQNLTSTASSGTNVHGSPRSAVVRRSNTSPMGFLRPG
  SCSPVPADTAQTVGRRLSTGSSRPYSPSPLVGTIPEQFSQCCCGHPQGHDSRSRNSSGSPVPQAQSPQSLLSGAR
  LQSAPTLTDIYQNKQKLRKQHSDPVCPSHTGAGYSYSPQPSRPGSLGTSPTKHLGSSPRSSDWFFKTPLPTIIGS
  PTKTTAPFKIPKTQASSNLLALVTRHGPAEEQSKDGNEPRECAHCLLVQGSERQRAEQQSKAVFGRSVSTGKLSD
  QQGKTPICRHQGSTDSLNTERPMDIAPAGACGGVLAPPAGTAASSKAVLFTVGSPPHSAAAPTCTHMFLRTRTTS
  VGPSNSGGSLCAMSGRVCVGSPPGPGFGSSPPGAEAAPSLRYVPYGASPPSLEGLITFEAPELPEETLMEREHTD
  TLRHLNVMLMFTECVLDLTAMRGGNPELCTSAVSLYQIQESVVVDQISQLSKDWGRVEQLVLYMKAAQLLAASLH
  LAKAQIKSGKLSPSTAVKQVVKNLNERYKFCITMCKKLTEKLNRFFSDKQRFIDEINSVTAEKLIYNCAVEMVQS
  AALDEMFQQTEDIVYRYHKAALLLEGLSRILQDPADIENVHKYKCSIERRLSALCHSTATV

• Structural information:
  • Protein Domains: (9..27-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR016237  IPR008271   IPR022708  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 6QAT 6QAU 6QAV
  • PDBsum: 6QAT 6QAU 6QAV
  • STRING: ENSP00000378914
• Other Databases: GeneCards:  ULK2  Malacards:  ULK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048675	axon extension	IBA	biological process
GO:0046777	protein autophosphorylation	IBA	biological process
GO:0010506	regulation of autophagy	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0000407	phagophore assembly site	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000045	autophagosome assembly	IBA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0034045	phagophore assembly site membrane	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0042594	response to starvation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0006914	autophagy	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0034045	phagophore assembly site membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0048675	axon extension	IEA	biological process
GO:0048671	negative regulation of collateral sprouting	IEA	biological process
GO:0042594	response to starvation	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0006914	autophagy	IDA	biological process
GO:0075044	positive regulation by symbiont of host autophagy	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa04150	mTOR signaling pathway
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal
hsa04136	Autophagy - other

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq