• Gene id: 9702

Gene Summary

• Gene Symbol: CEP57   Gene   UCSC   Ensembl
• Aliases: MVA2, PIG8, TSP57
• Gene name: centrosomal protein 57
• Alternate names: centrosomal protein of 57 kDa, FGF2-interacting protein, centrosomal protein 57kDa, proliferation-inducing protein 8, testis-specific protein 57, translokin,
• Gene location: 11q21 (95790460: 95832692)     Exons: 13     NC_000011.10
• Gene summary(Entrez): This gene encodes a cytoplasmic protein called Translokin. This protein localizes to the centrosome and has a function in microtubular stabilization. The N-terminal half of this protein is required for its centrosome localization and for its multimerizati
• OMIM: 607951

Protein Summary

• Protein general information: Q86XR8  
  • Name: Centrosomal protein of 57 kDa (Cep57) (FGF2 interacting protein) (Testis specific protein 57) (Translokin)
  • Length: 500  
  • Mass: 57089
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKN
  LQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYM
  RNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERK
  RMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPS
  HAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMS
  FDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNS
  SSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY

• Structural information:
  • Interpro: IPR010597  IPR025913  IPR024957  
  • PDB: 4L0R
  • PDBsum: 4L0R
  • STRING: ENSP00000317902
• Other Databases: GeneCards:  CEP57  Malacards:  CEP57

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007286	spermatid development	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:0008017	microtubule binding	IBA	molecular function
GO:0005813	centrosome	IDA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0034453	microtubule anchoring	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043015	gamma-tubulin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0010389	regulation of G2/M transition of mitotic cell cycle	TAS	biological process
GO:0097711	ciliary basal body-plasma membrane docking	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008017	microtubule binding	IEA	molecular function
GO:0007286	spermatid development	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0051260	protein homooligomerization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005874	microtubule	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IPI	biological process

Diseases

Associated diseases	References
Mosaic variegated aneuploidy syndrome	KEGG:H01288
Mosaic variegated aneuploidy syndrome	KEGG:H01288
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R