• Gene id: 9697

Gene Summary

• Gene Symbol: TRAM2   Gene   UCSC   Ensembl
• Gene name: translocation associated membrane protein 2
• Alternate names: translocating chain-associated membrane protein 2, TRAM-like protein,
• Gene location: 6p12.2 (52577059: 52497404)     Exons: 12     NC_000006.12
• Gene summary(Entrez): TRAM2 is a component of the translocon, a gated macromolecular channel that controls the posttranslational processing of nascent secretory and membrane proteins at the endoplasmic reticulum (ER) membrane.[supplied by OMIM, Jul 2004]
• OMIM: 608485

Protein Summary

• Protein general information: Q15035  
  • Name: Translocating chain associated membrane protein 2
  • Length: 370  
  • Mass: 43328
• Sequence:

  MAFRRRTKSYPLFSQEFVIHNHADIGFCLVLCVLIGLMFEVTAKTAFLFILPQYNISVPTADSETVHYHYGPKDL
  VTILFYIFITIILHAVVQEYILDKISKRLHLSKVKHSKFNESGQLVVFHFTSVIWCFYVVVTEGYLTNPRSLWED
  YPHVHLPFQVKFFYLCQLAYWLHALPELYFQKVRKEEIPRQLQYICLYLVHIAGAYLLNLSRLGLILLLLQYSTE
  FLFHTARLFYFADENNEKLFSAWAAVFGVTRLFILTLAVLAIGFGLARMENQAFDPEKGNFNTLFCRLCVLLLVC
  AAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKSP

• Structural information:
  • Protein Domains: (112..32-)
    (/note="TLC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00205"-)
  • Interpro: IPR006634  IPR013599  IPR016447  
  • Prosite: PS50922
  • STRING: ENSP00000182527
• Other Databases: GeneCards:  TRAM2  Malacards:  TRAM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005791	rough endoplasmic reticulum	IBA	cellular component
GO:0045048	protein insertion into ER membrane	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006616	SRP-dependent cotranslational protein targeting to membrane, translocation	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032964	collagen biosynthetic process	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)