About Us

Search Result


Gene id 9689
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol BZW1   Gene   UCSC   Ensembl
Aliases BZAP45, Nbla10236
Gene name basic leucine zipper and W2 domains 1
Alternate names basic leucine zipper and W2 domain-containing protein 1, basic leucine-zipper protein BZAP45, putative protein product of Nbla10236,
Gene location 2q33.1 (200811545: 200827337)     Exons: 15     NC_000002.12

Protein Summary

Protein general information Q7L1Q6  

Name: Basic leucine zipper and W2 domain containing protein 1 (Protein Orf)

Length: 419  Mass: 48043

Sequence MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGTDLEAVAKFLDASGAKLDYRRYAETLFDILV
AGGMLAPGGTLADDMMRTDVCVFAAQEDLETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKL
AMLTGVLLANGTLNASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPANKQS
VEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEEMKKNNIPEPVVIGIVWSSV
MSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELTLLLKIQEYCYDNIHFMKAFQKIVVLFYKAEVLSEE
PILKWYKDAHVAKGKSVFLEQMKKFVEWLKNAEEESESEAEEGD
Structural information
Protein Domains
(247..41-)
(/note="W2-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00695"-)
Interpro:  IPR016024  IPR016021  IPR003307  
Prosite:   PS51363
MINT:  
STRING:   ENSP00000394316
Other Databases GeneCards:  BZW1  Malacards:  BZW1

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005737 cytoplasm
IBA cellular component
GO:0045296 cadherin binding
HDA molecular function
GO:0005737 cytoplasm
IDA cellular component
GO:0005737 cytoplasm
IDA cellular component
GO:0016020 membrane
HDA cellular component
GO:0003723 RNA binding
HDA molecular function
GO:0003723 RNA binding
HDA molecular function
Associated diseases References
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract