• Gene id: 9688

Gene Summary

• Gene Symbol: NUP93   Gene   UCSC   Ensembl
• Aliases: NIC96
• Gene name: nucleoporin 93
• Alternate names: nuclear pore complex protein Nup93, 93 kDa nucleoporin, nucleoporin 93kDa, nucleoporin Nup93,
• Gene location: 16q13 (56730128: 56850285)     Exons: 25     NC_000016.10
• Gene summary(Entrez): The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex i
• OMIM: 614351

Protein Summary

• Protein general information: Q8N1F7  
  • Name: Nuclear pore complex protein Nup93 (93 kDa nucleoporin) (Nucleoporin Nup93)
  • Length: 819  
  • Mass: 93488
• Sequence:

  MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKASVLLGSRGLDISHIS
  QRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKRTFGMAEEYHRESMLVEWEQVKQRILHTLLA
  SGEDALDFTQESEPSYISDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWT
  MVKQMTDVLLTPATDALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIK
  LPAPLPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKDRRLSPATENKLRLHY
  RRALRNNTDPYKRAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLEDYGE
  SHFTVNQQPFLYFQVLFLTAQFEAAVAFLFRMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRR
  LNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDK
  FTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLELMNKLLSPVVPQISAPQSNKERLKNMALSIAERYR
  AQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQESVEERVAAFRNFSDEIRHNLSEVLL
  ATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN

• Structural information:
  • Interpro: IPR007231  
  • PDB: 5IJN 5IJO
  • PDBsum: 5IJN 5IJO
  • DIP: 44020
  • STRING: ENSP00000310668
• Other Databases: GeneCards:  NUP93  Malacards:  NUP93

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017056	structural constituent of nuclear pore	IBA	molecular function
GO:0016973	poly(A)+ mRNA export from nucleus	IBA	biological process
GO:0005643	nuclear pore	IBA	cellular component
GO:0006606	protein import into nucleus	IBA	biological process
GO:0034399	nuclear periphery	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0005643	nuclear pore	IDA	cellular component
GO:0051292	nuclear pore complex assembly	IDA	biological process
GO:0060395	SMAD protein signal transduction	IDA	biological process
GO:0006998	nuclear envelope organization	IDA	biological process
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0060391	positive regulation of SMAD protein signal transduction	IDA	biological process
GO:0051292	nuclear pore complex assembly	IMP	biological process
GO:0017056	structural constituent of nuclear pore	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005643	nuclear pore	IEA	cellular component
GO:0017056	structural constituent of nuclear pore	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0005643	nuclear pore	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0005635	nuclear envelope	TAS	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0006409	tRNA export from nucleus	TAS	biological process
GO:0016032	viral process	TAS	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0060964	regulation of gene silencing by miRNA	TAS	biological process
GO:0006110	regulation of glycolytic process	TAS	biological process
GO:0019083	viral transcription	TAS	biological process
GO:0075733	intracellular transport of virus	TAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060395	SMAD protein signal transduction	IEA	biological process
GO:0060391	positive regulation of SMAD protein signal transduction	IEA	biological process
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005643	nuclear pore	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0060395	SMAD protein signal transduction	IMP	biological process
GO:0043657	host cell	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Nephrotic syndrome	KEGG:H01657
Nephrotic syndrome	KEGG:H01657
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881