• Gene id: 9686

Gene Summary

• Gene Symbol: VGLL4   Gene   UCSC   Ensembl
• Aliases: VGL-4
• Gene name: vestigial like family member 4
• Alternate names: transcription cofactor vestigial-like protein 4, Vestigial-like 4, vestigial like 4,
• Gene location: 3p25.3-p25.2 (11720714: 11556066)     Exons: 14     NC_000003.12
• OMIM: 615250

Protein Summary

• Protein general information: Q14135  
  • Name: Transcription cofactor vestigial like protein 4 (Vgl 4)
  • Length: 290  
  • Mass: 30948
• Sequence:

  METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPPISPSKRKFSMEPGDEDLDCDNDHVS
  KMSRIFNPHLNKTANGDCRRDPRERSRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSP
  TLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPSAATTCDPVVEEHFRRSLGKNYKEPE
  PAPNSVSITGSVDDHFAKALGDTWLQIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS

• Structural information:
  • Interpro: IPR006627  IPR028184  
  • STRING: ENSP00000404251
• Other Databases: GeneCards:  VGLL4  Malacards:  VGLL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0001223	transcription coactivator binding	IBA	molecular function
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0035331	negative regulation of hippo signaling	IDA	biological process
GO:0030178	negative regulation of Wnt signaling pathway	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:1903364	positive regulation of cellular protein catabolic process	ISS	biological process
GO:0060044	negative regulation of cardiac muscle cell proliferation	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0035331	negative regulation of hippo signaling	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq