• Gene id: 9684

Gene Summary

• Gene Symbol: LRRC14   Gene   UCSC   Ensembl
• Aliases: LRRC14A
• Gene name: leucine rich repeat containing 14
• Alternate names: leucine-rich repeat-containing protein 14,
• Gene location: 8q24.3 (144517964: 144525171)     Exons: 5     NC_000008.11
• Gene summary(Entrez): This gene encodes a leucine-rich repeat-containing protein. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Dec 2012]
• OMIM: 609770

Protein Summary

• Protein general information: Q15048  
  • Name: Leucine rich repeat containing protein 14
  • Length: 493  
  • Mass: 54513
• Sequence:

  MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTVVLRELVHTWPFPLLSFQQLLQECAHCSRAL
  LQERPSTESMQAVILGLTARLHTSEPGASTQPLCRKHALRVLDMTGLLDDGVEQDPGTMSMWDCTAAVARTCIAQ
  QQGGAAEPGPAPIPVEVRVDLRVNRASYAFLREALRSSVGSPLRLCCRDLRAEDLPMRNTVALLQLLDAGCLRRV
  DLRFNNLGLRGLSVIIPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQMGRFTCLRELSMGSSLLSGRL
  DQLLSTLQSPLESLELAFCALLPEDLRFLARSPHAAHLKKLDLSGNDLSGSQLAPFQGLLQASAATLLHLELTEC
  QLADTQLLATLPILTQCASLRYLGLYGNPLSMAGLKELLRDSVAQAELRTVVHPFPVDCYEGLPWPPPASVLLEA
  SINEEKFARVEAELHQLLLASGRAHVLWTTDIYGRLAADYFSL

• Structural information:
  • Interpro: IPR001611  IPR032675  IPR026292  
  • STRING: ENSP00000292524
• Other Databases: GeneCards:  LRRC14  Malacards:  LRRC14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0019900	kinase binding	IBA	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IBA	biological process
GO:0034122	negative regulation of toll-like receptor signaling pathway	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0019900	kinase binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq