• Gene id: 9682

Gene Summary

• Gene Symbol: KDM4A   Gene   UCSC   Ensembl
• Aliases: JHDM3A, JMJD2, JMJD2A, TDRD14A
• Gene name: lysine demethylase 4A
• Alternate names: lysine-specific demethylase 4A, jmjC domain-containing histone demethylation protein 3A, jumonji C domain-containing histone demethylase 3A, jumonji domain containing 2, jumonji domain containing 2A, jumonji domain-containing protein 2A, lysine (K)-specific dem,
• Gene location: 1p34.2-p34.1 (91398620: 92867236)     Exons: 14     NC_000013.11
• Gene summary(Entrez): This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demeth
• OMIM: 609764

Protein Summary

• Protein general information: O75164  
  • Name: Lysine specific demethylase 4A (EC 1.14.11. ) (JmjC domain containing histone demethylation protein 3A) (Jumonji domain containing protein 2A)
  • Length: 1064  
  • Mass: 120662
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MASESETLNPSARIMTFYPTMEEFRNFSRYIAYIESQGAHRAGLAKVVPPKEWKPRASYDDIDDLVIPAPIQQLV
  TGQSGLFTQYNIQKKAMTVREFRKIANSDKYCTPRYSEFEELERKYWKNLTFNPPIYGADVNGTLYEKHVDEWNI
  GRLRTILDLVEKESGITIEGVNTPYLYFGMWKTSFAWHTEDMDLYSINYLHFGEPKSWYSVPPEHGKRLERLAKG
  FFPGSAQSCEAFLRHKMTLISPLMLKKYGIPFDKVTQEAGEFMITFPYGYHAGFNHGFNCAESTNFATRRWIEYG
  KQAVLCSCRKDMVKISMDVFVRKFQPERYKLWKAGKDNTVIDHTLPTPEAAEFLKESELPPRAGNEEECPEEDME
  GVEDGEEGDLKTSLAKHRIGTKRHRVCLEIPQEVSQSELFPKEDLSSEQYEMTECPAALAPVRPTHSSVRQVEDG
  LTFPDYSDSTEVKFEELKNVKLEEEDEEEEQAAAALDLSVNPASVGGRLVFSGSKKKSSSSLGSGSSRDSISSDS
  ETSEPLSCRAQGQTGVLTVHSYAKGDGRVTVGEPCTRKKGSAARSFSERELAEVADEYMFSLEENKKSKGRRQPL
  SKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQ
  TYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDINLSTPYLEEDGTSILVSCKKCSVRVHASCY
  GVPPAKASEDWMCSRCSANALEEDCCLCSLRGGALQRANDDRWVHVSCAVAILEARFVNIAERSPVDVSKIPLPR
  FKLKCIFCKKRRKRTAGCCVQCSHGRCPTAFHVSCAQAAGVMMQPDDWPFVVFITCFRHKIPNLERAKGALQSIT
  AGQKVISKHKNGRFYQCEVVRLTTETFYEVNFDDGSFSDNLYPEDIVSQDCLQFGPPAEGEVVQVRWTDGQVYGA
  KFVASHPIQMYQVEFEDGSQLVVKRDDVYTLDEELPKRVKSRLSVASDMRFNEIFTEKEVKQEKKRQRVINSRYR
  EDYIEPALYRAIME

• Structural information:
  • Protein Domains: (14..5-)
    (/note="JmjN-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00537-)
    (142..30-)
    (/note="JmjC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00538-)
    (897..95-)
    (/note="Tudor-1)
    (955..101-)
    (/note="Tudor-2")
  • Interpro: IPR034732  IPR003347  IPR003349  IPR040477  IPR002999   IPR011011  IPR001965  IPR013083  
  • Prosite: PS51805 PS51184 PS51183
  • PDB: 2GF7 2GFA 2GP3 2GP5 2OQ6 2OQ7 2OS2 2OT7 2OX0 2P5B 2PXJ 2Q8C 2Q8D 2Q8E 2QQR 2QQS 2VD7 2WWJ 2YBK 2YBP 2YBS 3NJY 3PDQ 3RVH 3U4S 4AI9 4BIS 4GD4 4URA 4V2V 4V2W 5A7N 5A7O 5A7P 5A7Q 5A7S 5A7W 5A80 5ANQ 5D6W 5D6X 5D6Y 5F2S 5F2W 5F32 5F37 5F39 5F3C 5F3E 5F3G 5F3I 5F5I 5FPV 5FWE 5FY8 5FYC 5FYH 5FYI 5LY1 5LY2 5TVR 5TVS 5VAR 5VG
  • PDBsum: 2GF7 2GFA 2GP3 2GP5 2OQ6 2OQ7 2OS2 2OT7 2OX0 2P5B 2PXJ 2Q8C 2Q8D 2Q8E 2QQR 2QQS 2VD7 2WWJ 2YBK 2YBP 2YBS 3NJY 3PDQ 3RVH 3U4S 4AI9 4BIS 4GD4 4URA 4V2V 4V2W 5A7N 5A7O 5A7P 5A7Q 5A7S 5A7W 5A80 5ANQ 5D6W 5D6X 5D6Y 5F2S 5F2W 5F32 5F37 5F39 5F3C 5F3E 5F3G 5F3I 5F5I 5FPV 5FWE 5FY8 5FYC 5FYH 5FYI 5LY1 5LY2 5TVR 5TVS 5VAR 5VG
  • DIP: 29372
  • STRING: ENSP00000361473
• Other Databases: GeneCards:  KDM4A  Malacards:  KDM4A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010507	negative regulation of autophagy	IMP	biological process
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0006338	chromatin remodeling	IBA	biological process
GO:0032452	histone demethylase activity	IBA	molecular function
GO:0051864	histone demethylase activity (H3-K36 specific)	IBA	molecular function
GO:0032454	histone demethylase activity (H3-K9 specific)	IBA	molecular function
GO:0035097	histone methyltransferase complex	IBA	cellular component
GO:0008270	zinc ion binding	IDA	molecular function
GO:0035064	methylated histone binding	IDA	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0032454	histone demethylase activity (H3-K9 specific)	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0051864	histone demethylase activity (H3-K36 specific)	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0016577	histone demethylation	IDA	biological process
GO:0070544	histone H3-K36 demethylation	IDA	biological process
GO:0051864	histone demethylase activity (H3-K36 specific)	IDA	molecular function
GO:0032454	histone demethylase activity (H3-K9 specific)	IMP	molecular function
GO:0033169	histone H3-K9 demethylation	IMP	biological process
GO:0005634	nucleus	IMP	cellular component

Diseases

Associated diseases	References
Prostate cancer	PMID:22120715
urinary bladder cancer	PMID:23603248
lung cancer	PMID:23168260
Breast cancer	PMID:22199269
stomach carcinoma	PMID:24802408
Alopecia areata	PMID:21936853
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq