• Gene id: 967

Gene Summary

• Gene Symbol: CD63   Gene   UCSC   Ensembl
• Aliases: LAMP-3, ME491, MLA1, OMA81H, TSPAN30
• Gene name: CD63 molecule
• Alternate names: CD63 antigen, CD63 antigen (melanoma 1 antigen), granulophysin, lysosomal-associated membrane protein 3, lysosome-associated membrane glycoprotein 3, melanoma-associated antigen ME491, melanoma-associated antigen MLA1, ocular melanoma-associated antigen, tetraspa,
• Gene location: 12q13.2 (55729672: 55725322)     Exons: 12     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 155740

Protein Summary

• Protein general information: P08962  
  • Name: CD63 antigen (Granulophysin) (Lysosomal associated membrane protein 3) (LAMP 3) (Melanoma associated antigen ME491) (OMA81H) (Ocular melanoma associated antigen) (Tetraspanin 30) (Tspan 30) (CD antigen CD63)
  • Length: 238  
  • Mass: 25637
  • Tissue specificity: Detected in platelets (at protein level). Dysplastic nevi, radial growth phase primary melanomas, hematopoietic cells, tissue macrophages. {ECO
• Sequence:

  MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGA
  CKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAAN
  YTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFAC
  CLVKSIRSGYEVM

• Structural information:
  • Interpro: IPR042028  IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • CDD: cd03166
  • STRING: ENSP00000447730
• Other Databases: GeneCards:  CD63  Malacards:  CD63

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070062	extracellular exosome	IDA	cellular component
GO:1900746	regulation of vascular endothelial growth factor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0032585	multivesicular body membrane	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:0097487	multivesicular body, internal vesicle	IDA	cellular component
GO:0097487	multivesicular body, internal vesicle	IDA	cellular component
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:2001046	positive regulation of integrin-mediated signaling pathway	IMP	biological process
GO:2001046	positive regulation of integrin-mediated signaling pathway	IMP	biological process
GO:1900746	regulation of vascular endothelial growth factor signaling pathway	IMP	biological process
GO:0035646	endosome to melanosome transport	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0007160	cell-matrix adhesion	IMP	biological process
GO:0048757	pigment granule maturation	IMP	biological process
GO:0002092	positive regulation of receptor internalization	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005765	lysosomal membrane	TAS	cellular component
GO:1901379	regulation of potassium ion transmembrane transport	IDA	biological process
GO:0034613	cellular protein localization	IDA	biological process
GO:0010008	endosome membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0031088	platelet dense granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900746	regulation of vascular endothelial growth factor signaling pathway	IEA	biological process
GO:0050931	pigment cell differentiation	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0043473	pigmentation	IEA	biological process
GO:0005770	late endosome	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0005771	multivesicular body	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0031904	endosome lumen	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0032585	multivesicular body membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05205	Proteoglycans in cancer
hsa04142	Lysosome

Diseases

Associated diseases	References
Carotid artery disease	PMID:15817881
Diabetic neuropathy	PMID:10547212
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray