• Gene id: 9655

Gene Summary

• Gene Symbol: SOCS5   Gene   UCSC   Ensembl
• Aliases: CIS6, CISH6, Cish5, SOCS-5
• Gene name: suppressor of cytokine signaling 5
• Alternate names: suppressor of cytokine signaling 5, CIS-6, cytokine-inducible SH2 protein 6, cytokine-inducible SH2-containing protein 5,
• Gene location: 2p21 (184276021: 184293030)     Exons: 19     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene contains a SH2 domain and a SOCS BOX domain. The protein thus belongs to the suppressor of cytokine signaling (SOCS) family, also known as STAT-induced STAT inhibitor (SSI) protein family. SOCS family members are known to
• OMIM: 607094

Protein Summary

• Protein general information: O75159  
  • Name: Suppressor of cytokine signaling 5 (SOCS 5) (Cytokine inducible SH2 protein 6) (CIS 6) (Cytokine inducible SH2 containing protein 5)
  • Length: 536  
  • Mass: 61246
• Sequence:

  MDKVGKMWNNFKYRCQNLFGHEGGSRSENVDMNSNRCLSVKEKNISIGDSTPQQQSSPLRENIALQLGLSPSKNS
  SRRNQNCATEIPQIVEISIEKDNDSCVTPGTRLARRDSYSRHAPWGGKKKHSCSTKTQSSLDADKKFGRTRSGLQ
  RRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKPLFSNKRKIHLSELMLEKCPFPAGSD
  LAQKWHLIKQHTAPVSPHSTFFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
  PKLAPGMTEISGDSSAIPQANCDSEEDTTTLCLQSRRQKQRQISGDSHTHVSRQGAWKVHTQIDYIHCLVPDLLQ
  ITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYNRSLHARIEQWNHNFSFDAHDPCVFHSS
  TVTGLLEHYKDPSSCMFFEPLLTISLNRTFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRV
  RWLEREPVKAK

• Structural information:
  • Protein Domains: (381..47-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (471..52-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR000980  IPR036860  IPR022252  IPR028420  IPR037343   IPR001496  IPR036036  
  • Prosite: PS50001 PS50225
  • CDD: cd03739
  • STRING: ENSP00000305133
• Other Databases: GeneCards:  SOCS5  Malacards:  SOCS5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0007175	negative regulation of epidermal growth factor-activated receptor activity	IDA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0030971	receptor tyrosine kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0007173	epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007173	epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0032715	negative regulation of interleukin-6 production	IEA	biological process
GO:0045627	positive regulation of T-helper 1 cell differentiation	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0005154	epidermal growth factor receptor binding	IEA	molecular function
GO:0019221	cytokine-mediated signaling pathway	IEA	biological process
GO:0045629	negative regulation of T-helper 2 cell differentiation	IEA	biological process
GO:0071404	cellular response to low-density lipoprotein particle stimulus	IEA	biological process
GO:0071638	negative regulation of monocyte chemotactic protein-1 production	IEA	biological process
GO:0097699	vascular endothelial cell response to fluid shear stress	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0045627	positive regulation of T-helper 1 cell differentiation	ISS	biological process
GO:0045629	negative regulation of T-helper 2 cell differentiation	ISS	biological process
GO:0019221	cytokine-mediated signaling pathway	ISS	biological process
GO:0009968	negative regulation of signal transduction	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04630	JAK-STAT signaling pathway
hsa04917	Prolactin signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq