• Gene id: 965

Gene Summary

• Gene Symbol: CD58   Gene   UCSC   Ensembl
• Aliases: LFA-3, LFA3, ag3
• Gene name: CD58 molecule
• Alternate names: lymphocyte function-associated antigen 3, CD58 antigen, (lymphocyte function-associated antigen 3), surface glycoprotein LFA-3,
• Gene location: 1p13.1 (18830202: 18809350)     Exons: 3     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively splice
• OMIM: 153420

SNPs

rs215702

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000007.14   g.32360046G>A
NC_000007.13   g.32399658G>A
NG_051183.1   g.73179C>T|SEQ=[G/A]|GENE=PDE1C

Protein Summary

• Protein general information: P19256  
  • Name: Lymphocyte function associated antigen 3 (Ag3) (Surface glycoprotein LFA 3) (CD antigen CD58)
  • Length: 250  
  • Mass: 28147
• Sequence:

  MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFS
  SFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNS
  HRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAV
  ITTCIVLYMNGILKCDRKPDRTNSN

• Structural information:
  • Protein Domains: (30..12-)
    (/note="Ig-like"-)
  • Interpro: IPR036179  IPR013783  IPR015714  
  • PDB: 1CCZ 1CI5 1QA9
  • PDBsum: 1CCZ 1CI5 1QA9
  • STRING: ENSP00000358501
• Other Databases: GeneCards:  CD58  Malacards:  CD58

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IBA	cellular component
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0071346	cellular response to interferon-gamma	IDA	biological process
GO:0034113	heterotypic cell-cell adhesion	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:2000484	positive regulation of interleukin-8 secretion	IMP	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005102	signaling receptor binding	IPI	molecular function
GO:0098609	cell-cell adhesion	NAS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05169	Epstein-Barr virus infection
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq