• Gene id: 9648

Gene Summary

• Gene Symbol: GCC2   Gene   UCSC   Ensembl
• Aliases: GCC185, RANBP2L4, REN53
• Gene name: GRIP and coiled-coil domain containing 2
• Alternate names: GRIP and coiled-coil domain-containing protein 2, 185 kDa Golgi coiled-coil protein, CLL-associated antigen KW-11, CTCL tumor antigen se1-1, GCC protein, 185-kD, Golgi coiled-coil protein GCC185, Ran-binding protein 2-like 4, renal carcinoma antigen NY-REN-53,
• Gene location: 2q12.3 (108448560: 108509414)     Exons: 25     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a peripheral membrane protein localized to the trans-Golgi network. It is sensitive to brefeldin A. This encoded protein contains a GRIP domain which is thought to be used in targeting. Alternative splicing results in m
• OMIM: 612711

Protein Summary

• Protein general information: Q8IWJ2  
  • Name: GRIP and coiled coil domain containing protein 2 (185 kDa Golgi coiled coil protein) (GCC185) (CLL associated antigen KW 11) (CTCL tumor antigen se1 1) (Ran binding protein 2 like 4) (RanBP2L4) (Renal carcinoma antigen NY REN 53)
  • Length: 1684  
  • Mass: 195910
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MEDLVQDGVASPATPGTGKSKLETLPKEDLIKFAKKQMMLIQKAKSRCTELEKEIEELRSKPVTEGTGDIIKALT
  ERLDALLLEKAETEQQCLSLKKENIKMKQEVEDSVTKMGDAHKELEQSHINYVKEIENLKNELMAVRSKYSEDKA
  NLQKQLEEAMNTQLELSEQLKFQNNSEDNVKKLQEEIEKIRPGFEEQILYLQKQLDATTDEKKETVTQLQNIIEA
  NSQHYQKNINSLQEELLQLKAIHQEEVKELMCQIEASAKEHEAEINKLNELKENLVKQCEASEKNIQKKYECELE
  NLRKATSNANQDNQICSILLQENTFVEQVVNEKVKHLEDTLKELESQHSILKDEVTYMNNLKLKLEMDAQHIKDE
  FFHEREDLEFKINELLLAKEEQGCVIEKLKSELAGLNKQFCYTVEQHNREVQSLKEQHQKEISELNETFLSDSEK
  EKLTLMFEIQGLKEQCENLQQEKQEAILNYESLREIMEILQTELGESAGKISQEFESMKQQQASDVHELQQKLRT
  AFTEKDALLETVNRLQGENEKLLSQQELVPELENTIKNLQEKNGVYLLSLSQRDTMLKELEGKINSLTEEKDDFI
  NKLKNSHEEMDNFHKKCEREERLILELGKKVEQTIQYNSELEQKVNELTGGLEETLKEKDQNDQKLEKLMVQMKV
  LSEDKEVLSAEVKSLYEENNKLSSEKKQLSRDLEVFLSQKEDVILKEHITQLEKKLQLMVEEQDNLNKLLENEQV
  QKLFVKTQLYGFLKEMGSEVSEDSEEKDVVNVLQAVGESLAKINEEKCNLAFQRDEKVLELEKEIKCLQEESVVQ
  CEELKSLLRDYEQEKVLLRKELEEIQSEKEALQSDLLEMKNANEKTRLENQNLLIQVEEVSQTCSKSEIHNEKEK
  CFIKEHENLKPLLEQKELRDRRAELILLKDSLAKSPSVKNDPLSSVKELEEKIENLEKECKEKEEKINKIKLVAV
  KAKKELDSSRKETQTVKEELESLRSEKDQLSASMRDLIQGAESYKNLLLEYEKQSEQLDVEKERANNFEHRIEDL
  TRQLRNSTLQCETINSDNEDLLARIETLQSNAKLLEVQILEVQRAKAMVDKELEAEKLQKEQKIKEHATTVNELE
  ELQVQLQKQKKQLQKTMQELELVKKDAQQTTLMNMEIADYERLMKELNQKLTNKNNKIEDLEQEIKIQKQKQETL
  QEEITSLQSSVQQYEEKNTKIKQLLVKTKKELADSKQAETDHLILQASLKGELEASQQQVEVYKIQLAEITSEKH
  KIHEHLKTSAEQHQRTLSAYQQRVTALQEECRAAKAEQATVTSEFESYKVRVHNVLKQQKNKSMSQAETEGAKQE
  REHLEMLIDQLKIKLQDSQNNLQINVSELQTLQSEHDTLLERHNKMLQETVSKEAELREKLCSIQSENMMMKSEH
  TQTVSQLTSQNEVLRNSFRDQVRHLQEEHRKTVETLQQQLSKMEAQLFQLKNEPTTRSPVSSQQSLKNLRERRNT
  DLPLLDMHTVTREEGEGMETTDTESVSSASTYTQSLEQLLNSPETKLEPPLWHAEFTKEELVQKLSSTTKSADHL
  NGLLRETEATNAILMEQIKLLKSEIRRLERNQEREKSAANLEYLKNVLLQFIFLKPGSERERLLPVINTMLQLSP
  EEKGKLAAVAQGEEENASRSSGWASYLHSWSGLR

• Structural information:
  • Protein Domains: (1609..165-)
    (/note="GRIP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00250"-)
  • Interpro: IPR032023  IPR000237  
  • Prosite: PS50913
  • PDB: 3BBP
  • PDBsum: 3BBP
  • STRING: ENSP00000307939
• Other Databases: GeneCards:  GCC2  Malacards:  GCC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090161	Golgi ribbon formation	IBA	biological process
GO:0034499	late endosome to Golgi transport	IBA	biological process
GO:0034067	protein localization to Golgi apparatus	IBA	biological process
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0071955	recycling endosome to Golgi transport	IBA	biological process
GO:0070861	regulation of protein exit from endoplasmic reticulum	IBA	biological process
GO:0031023	microtubule organizing center organization	IBA	biological process
GO:0006622	protein targeting to lysosome	IBA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0090161	Golgi ribbon formation	IMP	biological process
GO:0090161	Golgi ribbon formation	IMP	biological process
GO:0034499	late endosome to Golgi transport	IMP	biological process
GO:0034453	microtubule anchoring	IMP	biological process
GO:0034067	protein localization to Golgi apparatus	IMP	biological process
GO:0034067	protein localization to Golgi apparatus	IMP	biological process
GO:0071955	recycling endosome to Golgi transport	IMP	biological process
GO:0070861	regulation of protein exit from endoplasmic reticulum	IMP	biological process
GO:0043001	Golgi to plasma membrane protein transport	IMP	NOT|biological process
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process
GO:0031023	microtubule organizing center organization	IMP	biological process
GO:0006622	protein targeting to lysosome	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)