• Gene id: 9646

Gene Summary

• Gene Symbol: CTR9   Gene   UCSC   Ensembl
• Aliases: SH2BP1, TSBP, p150, p150TSP
• Gene name: CTR9 homolog, Paf1/RNA polymerase II complex component
• Alternate names: RNA polymerase-associated protein CTR9 homolog, Ctr9, Paf1/RNA polymerase II complex component, homolog, SH2 domain binding protein 1 (tetratricopeptide repeat containing), TPR-containing, SH2-binding phosphoprotein,
• Gene location: 11p15.4 (10751245: 10779745)     Exons: 25     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a component of the PAF1 complex, which associates with RNA polymerase II and functions in transcriptional regulation and elongation. This complex also plays a role in the modification of histones. [provided by RefSeq, O
• OMIM: 609366

Protein Summary

• Protein general information: Q6PD62  
  • Name: RNA polymerase associated protein CTR9 homolog (SH2 domain binding protein 1)
  • Length: 1173  
  • Mass: 133502
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDY
  RDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADA
  QFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRAL
  ELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTE
  VEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENASQCFEKVLKAYPNNY
  ETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVP
  PEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILR
  EHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSD
  TYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHKGYFREARDVFAQVRE
  ATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVVLYLARALFKCGKLQECKQTLLKARHVAPSD
  TVLMFNVALVLQRLATSVLKDEKSNLKEVLNAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQ
  YHVARARKQDEEERELRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYVEKTKNILMFTGETEATKE
  KKRGGGGGRRSKKGGEFDEFVNDDTDDDLPISKKKKRRKGSGSEQEGEDEEGGERKKKKRRRHPKGEEGSDDDET
  ENGPKPKKRRPPKAEKKKAPKPERLPPSMKGKIKSKAIISSSDDSSDEDKLKIADEGHPRNSNSNSDSDEDEQRK
  KCASSESDSDENQNKSGSEAGSPRRPRRQRSDQDSDSDQPSRKRRPSGSEQSDNESVQSGRSHSGVSENDSRPAS
  PSAESDHESERGSDNEGSGQGSGNESEPEGSNNEASDRGSEHGSDDSD

• Structural information:
  • Interpro: IPR031101  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50005 PS50293
  • PDB: 5ZYQ 6GMH
  • PDBsum: 5ZYQ 6GMH
  • DIP: 31693
  • STRING: ENSP00000355013
• Other Databases: GeneCards:  CTR9  Malacards:  CTR9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000993	RNA polymerase II complex binding	IBA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0016593	Cdc73/Paf1 complex	IBA	cellular component
GO:0051569	regulation of histone H3-K4 methylation	IBA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IDA	biological process
GO:0019827	stem cell population maintenance	IDA	biological process
GO:0016593	Cdc73/Paf1 complex	IDA	cellular component
GO:0080182	histone H3-K4 trimethylation	IMP	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0070102	interleukin-6-mediated signaling pathway	ISS	biological process
GO:0051571	positive regulation of histone H3-K4 methylation	IMP	biological process
GO:0035327	transcriptionally active chromatin	ISS	cellular component
GO:0007259	receptor signaling pathway via JAK-STAT	ISS	biological process
GO:0001711	endodermal cell fate commitment	ISS	biological process
GO:2001162	positive regulation of histone H3-K79 methylation	IMP	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016570	histone modification	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0016567	protein ubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0080182	histone H3-K4 trimethylation	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0070102	interleukin-6-mediated signaling pathway	IEA	biological process
GO:0051571	positive regulation of histone H3-K4 methylation	IEA	biological process
GO:0035327	transcriptionally active chromatin	IEA	cellular component
GO:0007259	receptor signaling pathway via JAK-STAT	IEA	biological process
GO:0001835	blastocyst hatching	IEA	biological process
GO:0001826	inner cell mass cell differentiation	IEA	biological process
GO:0001711	endodermal cell fate commitment	IEA	biological process
GO:2000653	regulation of genetic imprinting	IEA	biological process
GO:0042169	SH2 domain binding	IEA	molecular function
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0016593	Cdc73/Paf1 complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001832	blastocyst growth	IEA	biological process
GO:0001829	trophectodermal cell differentiation	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006368	transcription elongation from RNA polymerase II promoter	IDA	biological process
GO:0016593	Cdc73/Paf1 complex	IDA	cellular component
GO:0010390	histone monoubiquitination	IDA	biological process
GO:0033523	histone H2B ubiquitination	IDA	biological process
GO:1900364	negative regulation of mRNA polyadenylation	IMP	biological process
GO:2001168	positive regulation of histone H2B ubiquitination	IMP	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq