• Gene id: 9645

Gene Summary

• Gene Symbol: MICAL2   Gene   UCSC   Ensembl
• Aliases: MICAL-2, MICAL2PV1, MICAL2PV2
• Gene name: microtubule associated monooxygenase, calponin and LIM domain containing 2
• Alternate names: [F-actin]-monooxygenase MICAL2, [F-actin]-methionine sulfoxide oxidase MICAL2, flavoprotein oxidoreductase MICAL2, microtubule associated monoxygenase, calponin and LIM domain containing 2, molecule interacting with CasL protein 2, protein-methionine sulfoxide,
• Gene location: 11p15.3 (12110575: 12263789)     Exons: 29     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a monooxygenase that enhances depolymerization of F-actin and is therefore involved in cytoskeletal dynamics. The encoded protein is a regulator of the SRF signaling pathway. Increased expression of this gene has been a

Protein Summary

• Protein general information: O94851  
  • Name: [F actin] monooxygenase MICAL2 (EC 1.14.13.225) (Molecule interacting with CasL protein 2) (MICAL 2)
  • Length: 1124  
  • Mass: 126689
• Sequence:

  MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTWKAKALWYKLDKRGSH
  KEYKRGKSCTNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDSFSRNNVLHLWPFTIHDLRGLGAKKFYGKFC
  AGSIDHISIRQLQLILFKVALMLGVEIHVNVEFVKVLEPPEDQENQKIGWRAEFLPTDHSLSEFEFDVIIGADGR
  RNTLEGFRRKEFRGKLAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
  MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNHYGQPDVAMFDFTCMY
  ASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFDTAWMVKSWNQGTPPLELLAERESLYRLLPQ
  TTPENINKNFEQYTLDPGTRYPNLNSHCVRPHQVKHLYITKELEHYPLERLGSVRRSVNLSRKESDIRPSKLLTW
  CQQQTEGYQHVNVTDLTTSWRSGLALCAIIHRFRPELINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
  SAQEPDKLSMVMYLSKFYELFRGTPLRPVDSWRKNYGENADLSLAKSSISNNYLNLTFPRKRTPRVDGQTGENDM
  NKRRRKGFTNLDEPSNFSSRSLGSNQECGSSKEGGNQNKVKSMANQLLAKFEESTRNPSLMKQERRVSGIGKPVL
  CSSSGPPVHSCCPKPEEATPSPSPPLKRQFPSVVVTGHVLRELKQVSAGSECLSRPWRARAKSDLQLGGTENFAT
  LPSTRPRAQALSGVLWRLQQVEEKILQKRAQNLANREFHTKNIKEKAAHLASMFGHGDFPQNKLLSKGLSHTHPP
  SPPSRLPSPDPAASSSPSTVDSASPARKEKKSPSGFHFHPSHLRTVHPQLTVGKVSSGIGAAAEVLVNLYMNDHR
  PKAQATSPDLESMRKSFPLNLGGSDTCYFCKKRVYVMERLSAEGHFFHRECFRCSICATTLRLAAYTFDCDEGKF
  YCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESSCAVAAIGTLEGSPPVHFSLPVLHPLLG

• Structural information:
  • Protein Domains: (516..61-)
    (/note="Calponin-homology-(CH))
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00044-)
    (1000..106-)
    (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125"-)
  • Interpro: IPR001715  IPR036872  IPR002938  IPR036188  IPR029939   IPR001781  
  • Prosite: PS50021 PS00478 PS50023
  • CDD: cd00014
  • PDB: 2E9K
  • PDBsum: 2E9K
  • STRING: ENSP00000256194
• Other Databases: GeneCards:  MICAL2  Malacards:  MICAL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0005815	microtubule organizing center	IBA	cellular component
GO:0031941	filamentous actin	IBA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0007010	cytoskeleton organization	IDA	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0016491	oxidoreductase activity	IDA	molecular function
GO:0030042	actin filament depolymerization	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0071949	FAD binding	ISS	molecular function
GO:0055114	oxidation-reduction process	ISS	biological process
GO:0019417	sulfur oxidation	ISS	biological process
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	ISS	molecular function
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	ISS	molecular function
GO:0003779	actin binding	ISS	molecular function
GO:0003779	actin binding	ISS	molecular function
GO:0001947	heart looping	ISS	biological process
GO:0030042	actin filament depolymerization	ISS	biological process
GO:0030042	actin filament depolymerization	ISS	biological process
GO:0010735	positive regulation of transcription via serum response element binding	IMP	biological process
GO:0007507	heart development	ISS	biological process
GO:0003779	actin binding	IEA	molecular function
GO:0071949	FAD binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0010735	positive regulation of transcription via serum response element binding	IEA	biological process
GO:0030042	actin filament depolymerization	IEA	biological process
GO:0043914	NADPH:sulfur oxidoreductase activity	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0019417	sulfur oxidation	IEA	biological process
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IEA	molecular function
GO:0016174	NAD(P)H oxidase (H(2)O(2)-forming activity	IEA	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0030042	actin filament depolymerization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray