About Us

Search Result


Gene id 9643
Gene Summary    Protein Summary    Gene ontology    Diseases    PubMed    

Gene Summary

Gene Symbol MORF4L2   Gene   UCSC   Ensembl
Aliases MORFL2, MRGX
Gene name mortality factor 4 like 2
Alternate names mortality factor 4-like protein 2, MORF-related gene X protein, MSL3-2 protein, protein MSL3-2, transcription factor-like protein MRGX,
Gene location Xq22.2 (103688157: 103675497)     Exons: 6     NC_000023.11
OMIM 300409

Protein Summary

Protein general information Q15014  

Name: Mortality factor 4 like protein 2 (MORF related gene X protein) (Protein MSL3 2) (Transcription factor like protein MRGX)

Length: 288  Mass: 32308

Sequence MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWGGRSAENPPSGSVRKT
RKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRMEVKVKIPEELKPWLVEDWDLVTRQKQLFQLP
AKKNVDAILEEYANCKKSQGNVDNKEYAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGA
PHLLRLFVRIGAMLAYTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL
Structural information
Protein Domains
(117..28-)
(/note="MRG-)
(/evidence="ECO:0000255|PROSITE-ProRule:PRU00972"-)
Interpro:  IPR008676  IPR038217  IPR026541  IPR038012  
Prosite:   PS51640
MINT:  
STRING:   ENSP00000394417
Other Databases GeneCards:  MORF4L2  Malacards:  MORF4L2

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0005730 nucleolus
IDA cellular component
GO:0005515 protein binding
IPI molecular function
GO:0035267 NuA4 histone acetyltransf
erase complex
IBA cellular component
GO:0043968 histone H2A acetylation
IBA biological process
GO:0043967 histone H4 acetylation
IBA biological process
GO:0016575 histone deacetylation
IBA biological process
GO:0016573 histone acetylation
IBA biological process
GO:0006342 chromatin silencing
IBA biological process
GO:0000123 histone acetyltransferase
complex
IBA cellular component
GO:0006281 DNA repair
IEA biological process
GO:0006325 chromatin organization
IEA biological process
GO:0006974 cellular response to DNA
damage stimulus
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0040008 regulation of growth
IEA biological process
GO:0006325 chromatin organization
IEA biological process
GO:0035267 NuA4 histone acetyltransf
erase complex
IEA cellular component
GO:0005634 nucleus
IEA cellular component
GO:0006355 regulation of transcripti
on, DNA-templated
IEA biological process
GO:0005654 nucleoplasm
TAS cellular component
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0005515 protein binding
IPI molecular function
GO:0045944 positive regulation of tr
anscription by RNA polyme
rase II
IEA biological process
GO:0051155 positive regulation of st
riated muscle cell differ
entiation
IEA biological process
GO:0005634 nucleus
IEA cellular component
GO:0005654 nucleoplasm
IDA cellular component
GO:0005886 plasma membrane
IDA cellular component
Associated diseases References
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
17327269 Teratozoos
permia

19 (6 controls
, 13 cases)
Male infertility GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract