• Gene id: 9641

Gene Summary

• Gene Symbol: IKBKE   Gene   UCSC   Ensembl
• Aliases: IKK-E, IKK-i, IKKE, IKKI
• Gene name: inhibitor of nuclear factor kappa B kinase subunit epsilon
• Alternate names: inhibitor of nuclear factor kappa-B kinase subunit epsilon, I-kappa-B kinase epsilon, IKK-epsilon, IKK-related kinase epsilon, inducible I kappa-B kinase, inducible IkappaB kinase, inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon,
• Gene location: 1q32.1 (206470242: 206496889)     Exons: 22     NC_000001.11
• Gene summary(Entrez): IKBKE is a noncanonical I-kappa-B (see MIM 164008) kinase (IKK) that is essential for regulating antiviral signaling pathways. IKBKE has also been identified as a breast cancer (MIM 114480) oncogene and is amplified and overexpressed in over 30% of breast
• OMIM: 605048

Protein Summary

• Protein general information: Q14164  
  • Name: Inhibitor of nuclear factor kappa B kinase subunit epsilon (I kappa B kinase epsilon) (IKK E) (IKK epsilon) (IkBKE) (EC 2.7.11.10) (Inducible I kappa B kinase) (IKK i)
  • Length: 716  
  • Mass: 80462
  • Tissue specificity: Highly expressed in spleen followed by thymus, peripheral blood leukocytes, pancreas, placenta. Weakly expressed in lung, kidney, prostate, ovary and colon.
• Sequence:

  MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLRKLNHQNIVKLFAVEE
  TGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVVAGMNHLRENGIVHRDIKPGNIMRLVGEEGQ
  SIYKLTDFGAARELDDDEKFVSVYGTEEYLHPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFG
  GPRRNKEIMYRITTEKPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
  ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCVLEPSVSAQHIAHTTA
  SSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLGAGYQALRLARALLDGQELMFRGLHWVMEVL
  QATCRRTLEVARTSLLYLSSSLGTERFSSVAGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNR
  ELVKSRDQVHEDRSIQQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
  QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKGAQASPPPIAPYPSPT
  RKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV

• Structural information:
  • Protein Domains: (9..31-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR041309  IPR041087  
  • Prosite: PS00107 PS50011
  • DIP: 27530
  • STRING: ENSP00000464030
• Other Databases: GeneCards:  IKBKE  Malacards:  IKBKE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019903	protein phosphatase binding	ISS	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0016605	PML body	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0008384	IkappaB kinase activity	IEA	molecular function
GO:0031966	mitochondrial membrane	IMP	cellular component
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0010008	endosome membrane	TAS	cellular component
GO:0032480	negative regulation of type I interferon production	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0035666	TRIF-dependent toll-like receptor signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098586	cellular response to virus	IEA	biological process
GO:0036435	K48-linked polyubiquitin modification-dependent protein binding	IEA	molecular function
GO:0010884	positive regulation of lipid storage	IEA	biological process
GO:0008384	IkappaB kinase activity	IEA	molecular function
GO:0060340	positive regulation of type I interferon-mediated signaling pathway	IEA	biological process
GO:0034340	response to type I interferon	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0010884	positive regulation of lipid storage	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0038061	NIK/NF-kappaB signaling	IEA	biological process
GO:0007252	I-kappaB phosphorylation	IEA	biological process
GO:0007252	I-kappaB phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004704	NF-kappaB-inducing kinase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0006955	immune response	NAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070530	K63-linked polyubiquitin modification-dependent protein binding	IMP	NOT|molecular function
GO:0036435	K48-linked polyubiquitin modification-dependent protein binding	IMP	molecular function
GO:0035456	response to interferon-beta	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection
hsa05165	Human papillomavirus infection
hsa05169	Epstein-Barr virus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04621	NOD-like receptor signaling pathway
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05162	Measles
hsa04625	C-type lectin receptor signaling pathway
hsa04620	Toll-like receptor signaling pathway
hsa04657	IL-17 signaling pathway
hsa04622	RIG-I-like receptor signaling pathway
hsa04623	Cytosolic DNA-sensing pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq