• Gene id: 9638

Gene Summary

• Gene Symbol: FEZ1   Gene   UCSC   Ensembl
• Aliases: UNC-76
• Gene name: fasciculation and elongation protein zeta 1
• Alternate names: fasciculation and elongation protein zeta-1, zygin I, zygin-1,
• Gene location: 11q24.2 (125496309: 125442880)     Exons: 11     NC_000011.10
• Gene summary(Entrez): This gene is an ortholog of the C. elegans unc-76 gene, which is necessary for normal axonal bundling and elongation within axon bundles. Expression of this gene in C. elegans unc-76 mutants can restore to the mutants partial locomotion and axonal fascicu
• OMIM: 604825

Protein Summary

• Protein general information: Q99689  
  • Name: Fasciculation and elongation protein zeta 1 (Zygin I) (Zygin 1)
  • Length: 392  
  • Mass: 45119
  • Tissue specificity: Mainly expressed in brain.
• Sequence:

  MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKLNVCFR
  NYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHEKEEEEFNEKS
  ENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQALTQTFNNNWSYEGLR
  HMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNKQKEQRELMKKRRKEKGLSLQ
  SSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEKKASPPSVEDLQMLTNILFAMKEDNE
  KVPTLLTDYILKVLCPT

• Structural information:
  • Interpro: IPR011680  IPR015642  
  • DIP: 32494
  • STRING: ENSP00000278919
• Other Databases: GeneCards:  FEZ1  Malacards:  FEZ1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030424	axon	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0007411	axon guidance	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071363	cellular response to growth factor stimulus	IEA	biological process
GO:0070584	mitochondrion morphogenesis	IEA	biological process
GO:0045666	positive regulation of neuron differentiation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0005080	protein kinase C binding	IEA	molecular function
GO:0005813	centrosome	IEA	cellular component
GO:0061881	positive regulation of anterograde axonal transport of mitochondrion	IEA	biological process
GO:0051654	establishment of mitochondrion localization	IEA	biological process
GO:0047485	protein N-terminus binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0010976	positive regulation of neuron projection development	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043015	gamma-tubulin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:1902902	negative regulation of autophagosome assembly	IMP	biological process
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Schizophrenia	PMID:16510495
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)