• Gene id: 9626

Gene Summary

• Gene Symbol: GUCA1C   Gene   UCSC   Ensembl
• Aliases: GCAP3
• Gene name: guanylate cyclase activator 1C
• Alternate names: guanylyl cyclase-activating protein 3, GCAP 3,
• Gene location: 3q13.13 (108955194: 108907643)     Exons: 5     NC_000003.12
• OMIM: 607679

Protein Summary

• Protein general information: O95843  
  • Name: Guanylyl cyclase activating protein 3 (GCAP 3) (Guanylate cyclase activator 1C)
  • Length: 209  
  • Mass: 23822
  • Tissue specificity: Retina.
• Sequence:

  MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFVDFL
  EFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGEL
  TLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK

• Structural information:
  • Protein Domains: (15..5-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448,-ECO:0000269|PubMed:16626734)
    (52..8-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448,-ECO:0000269|PubMed:16626734)
    (88..12-)
    (/note="E-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR032992  IPR028846  
  • Prosite: PS00018 PS50222
  • CDD: cd00051
  • PDB: 2GGZ
  • PDBsum: 2GGZ
  • STRING: ENSP00000261047
• Other Databases: GeneCards:  GUCA1C  Malacards:  GUCA1C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IEA	molecular function
GO:0007601	visual perception	IEA	biological process
GO:0008048	calcium sensitive guanylate cyclase activator activity	IEA	molecular function
GO:0031282	regulation of guanylate cyclase activity	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0008048	calcium sensitive guanylate cyclase activator activity	TAS	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0007601	visual perception	TAS	biological process
GO:0022400	regulation of rhodopsin mediated signaling pathway	TAS	biological process
GO:0097381	photoreceptor disc membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04744	Phototransduction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq