• Gene id: 9623

Gene Summary

• Gene Symbol: TCL1B   Gene   UCSC   Ensembl
• Aliases: SYN-1, TML1
• Gene name: TCL1 family AKT coactivator B
• Alternate names: T-cell leukemia/lymphoma protein 1B, T cell leukemia/lymphoma 1B, T-cell lymphoma/leukemia 1B, TCL1/ MTCP1-like 1, oncogene TCL-1B, syncytiotrophoblast-specific protein,
• Gene location: 14q32.13 (95686425: 95692627)     Exons: 4     NC_000014.9

Protein Summary

• Protein general information: O95988  
  • Name: T cell leukemia/lymphoma protein 1B (Oncogene TCL 1B) (Oncogene TCL1B) (SYN 1) (Syncytiotrophoblast specific protein) (TCL1/MTCP1 like protein 1)
  • Length: 128  
  • Mass: 14846
  • Tissue specificity: Expressed in a variety of tissues including placenta and testis. {ECO
• Sequence:

  MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLS
  SGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD

• Structural information:
  • Interpro: IPR004832  IPR036672  
  • STRING: ENSP00000343223
• Other Databases: GeneCards:  TCL1B  Malacards:  TCL1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IBA	biological process
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0043539	protein serine/threonine kinase activator activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043539	protein serine/threonine kinase activator activity	IDA	molecular function
GO:0032991	protein-containing complex	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IDA	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881