• Gene id: 9622

Gene Summary

• Gene Symbol: KLK4   Gene   UCSC   Ensembl
• Aliases: AI2A1, ARM1, EMSP, EMSP1, KLK-L1, PRSS17, PSTS, kallikrein
• Gene name: kallikrein related peptidase 4
• Alternate names: kallikrein-4, androgen-regulated message 1, enamel matrix serine protease 1, enamel matrix serine proteinase 1, kallikrein-like protein 1, prostase, serine protease 17,
• Gene location: 19q13.41 (50910744: 50906351)     Exons: 6     NC_000019.10
• Gene summary(Entrez): Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one
• OMIM: 168890

Protein Summary

• Protein general information: Q9Y5K2  
  • Name: Kallikrein 4 (EC 3.4.21. ) (Enamel matrix serine proteinase 1) (Kallikrein like protein 1) (KLK L1) (Prostase) (Serine protease 17)
  • Length: 254  
  • Mass: 27032
  • Tissue specificity: Expressed in prostate.
• Sequence:

  MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAAHCFQN
  SYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIASQCPTAGNSCLV
  SGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGHDQKDSCNGDSGGPLICNGYLQGLVSFGK
  APCGQVGVPGVYTNLCKFTEWIEKTVQAS

• Structural information:
  • Protein Domains: (31..25-)
    (/note="Peptidase-S1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00274"-)
  • Interpro: IPR009003  IPR001314  IPR001254  IPR018114  IPR033116  
  • Prosite: PS50240 PS00134 PS00135
  • CDD: cd00190
  • PDB: 2BDG 2BDH 2BDI 4K1E 4K8Y 4KEL 4KGA 6KBR 6NVB 6O21
  • PDBsum: 2BDG 2BDH 2BDI 4K1E 4K8Y 4KEL 4KGA 6KBR 6NVB 6O21
  • STRING: ENSP00000326159
• Other Databases: GeneCards:  KLK4  Malacards:  KLK4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030141	secretory granule	IBA	cellular component
GO:0022617	extracellular matrix disassembly	IBA	biological process
GO:0097186	amelogenesis	IBA	biological process
GO:0097186	amelogenesis	IMP	biological process
GO:0004252	serine-type endopeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031214	biomineral tissue development	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	IEA	molecular function
GO:0008236	serine-type peptidase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0006508	proteolysis	NAS	biological process
GO:0008236	serine-type peptidase activity	NAS	molecular function

Diseases

Associated diseases	References
Amelogenesis imperfecta	KEGG:H00615
Amelogenesis imperfecta	KEGG:H00615
Prostate cancer	PMID:17545602
Prostate cancer	PMID:12370833
Breast cancer	PMID:18687310
Breast cancer	PMID:19190825
Ovarian cancer	PMID:15262123
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray