• Gene id: 9607

Gene Summary

• Gene Symbol: CARTPT   Gene   UCSC   Ensembl
• Aliases: CART
• Gene name: CART prepropeptide
• Alternate names: cocaine- and amphetamine-regulated transcript protein,
• Gene location: 5q13.2 (71719274: 71721044)     Exons: 3     NC_000005.10
• Gene summary(Entrez): This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expre

Protein Summary

• Protein general information: Q16568  
  • Name: Cocaine and amphetamine regulated transcript protein [Cleaved into: CART(1 39); CART(42 89)]
  • Length: 116  
  • Mass: 12829
  • Tissue specificity: Hypothalamus. Found in neurons of the ventrolateral part of the arcuate nucleus, in the external zone of the median eminence, and also found in terminals in the periventricular part of the paraventricular nucleus.
• Sequence:

  MESSRVRLLPLLGAALLLMLPLLGTRAQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKK
  YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL

• Structural information:
  • Interpro: IPR009106  IPR036722  
  • PDB: 1HY9
  • PDBsum: 1HY9
  • STRING: ENSP00000296777
• Other Databases: GeneCards:  CARTPT  Malacards:  CARTPT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0008343	adult feeding behavior	ISS	biological process
GO:0009267	cellular response to starvation	ISS	biological process
GO:0009267	cellular response to starvation	ISS	biological process
GO:0005615	extracellular space	ISS	cellular component
GO:0045777	positive regulation of blood pressure	IDA	biological process
GO:0032812	positive regulation of epinephrine secretion	IDA	biological process
GO:0032099	negative regulation of appetite	TAS	biological process
GO:0032099	negative regulation of appetite	ISS	biological process
GO:0045671	negative regulation of osteoclast differentiation	TAS	biological process
GO:0051971	positive regulation of transmission of nerve impulse	IDA	biological process
GO:0000186	activation of MAPKK activity	ISS	biological process
GO:0001678	cellular glucose homeostasis	IDA	biological process
GO:0045779	negative regulation of bone resorption	IMP	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0032099	negative regulation of appetite	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0009267	cellular response to starvation	IBA	biological process
GO:0005184	neuropeptide hormone activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0008343	adult feeding behavior	IEA	biological process
GO:0032099	negative regulation of appetite	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007218	neuropeptide signaling pathway	IEA	biological process
GO:0007268	chemical synaptic transmission	IEA	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070093	negative regulation of glucagon secretion	IEA	biological process
GO:0050796	regulation of insulin secretion	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0046850	regulation of bone remodeling	IEA	biological process
GO:0045779	negative regulation of bone resorption	IEA	biological process
GO:0009267	cellular response to starvation	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0000186	activation of MAPKK activity	IEA	biological process
GO:0070253	somatostatin secretion	IEA	biological process
GO:0032099	negative regulation of appetite	IEA	biological process
GO:0008343	adult feeding behavior	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0032099	negative regulation of appetite	IEA	biological process
GO:0008343	adult feeding behavior	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0030141	secretory granule	IDA	cellular component

Diseases

Associated diseases	References
Genetic obesity	KEGG:H02106
Genetic obesity	KEGG:H02106
obesity	PMID:11522684
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881