• Gene id: 9604

Gene Summary

• Gene Symbol: RNF14   Gene   UCSC   Ensembl
• Aliases: ARA54, HFB30, HRIHFB2038, TRIAD2
• Gene name: ring finger protein 14
• Alternate names: E3 ubiquitin-protein ligase RNF14, androgen receptor associated protein 54,
• Gene location: 5q31.3 (141966806: 141990291)     Exons: 13     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in pros
• OMIM: 605675

Protein Summary

• Protein general information: Q9UBS8  
  • Name: E3 ubiquitin protein ligase RNF14 (EC 2.3.2.31) (Androgen receptor associated protein 54) (HFB30) (RING finger protein 14) (Triad2 protein)
  • Length: 474  
  • Mass: 53837
  • Tissue specificity: Widely expressed.
• Sequence:

  MSSEDREAQEDELLALASIYDGDEFRKAESVQGGETRIYLDLPQNFKIFVSGNSNECLQNSGFEYTICFLPPLVL
  NFELPPDYPSSSPPSFTLSGKWLSPTQLSALCKHLDNLWEEHRGSVVLFAWMQFLKEETLAYLNIVSPFELKIGS
  QKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFC
  EKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSL
  DLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLL
  DQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPG
  SPCFNRLFYAVDVDDDIWEDEVED

• Structural information:
  • Protein Domains: (11..13-)
    (/note="RWD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00179"-)
  • Interpro: IPR031127  IPR002867  IPR006575  IPR016135  IPR001841   IPR013083  IPR017907  
  • Prosite: PS50908 PS51873 PS00518 PS50089
  • STRING: ENSP00000378028
• Other Databases: GeneCards:  RNF14  Malacards:  RNF14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0000151	ubiquitin ligase complex	IBA	cellular component
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0031624	ubiquitin conjugating enzyme binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0060765	regulation of androgen receptor signaling pathway	IDA	biological process
GO:0006355	regulation of transcription, DNA-templated	IDA	biological process
GO:0050681	androgen receptor binding	IPI	molecular function
GO:0004842	ubiquitin-protein transferase activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0019787	ubiquitin-like protein transferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0030521	androgen receptor signaling pathway	NAS	biological process
GO:0006357	regulation of transcription by RNA polymerase II	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0016567	protein ubiquitination	IEP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)