• Gene id: 960

Gene Summary

• Gene Symbol: CD44   Gene   UCSC   Ensembl
• Aliases: CDW44, CSPG8, ECMR-III, HCELL, HUTCH-I, IN, LHR, MC56, MDU2, MDU3, MIC4, Pgp1
• Gene name: CD44 molecule (Indian blood group)
• Alternate names: CD44 antigen, GP90 lymphocyte homing/adhesion receptor, Hermes antigen, cell surface glycoprotein CD44, chondroitin sulfate proteoglycan 8, epican, extracellular matrix receptor III, hematopoietic cell E- and L-selectin ligand, heparan sulfate proteoglyca,
• Gene location: 11p13 (35138869: 35232401)     Exons: 21     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix
• OMIM: 107269

Protein Summary

• Protein general information: P16070  
  • Name: CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP 1) (Phagocytic glycop
  • Length: 742  
  • Mass: 81,538
• Sequence:

  MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFE
  TCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNR
  DGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLM
  STSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDD
  EDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEE
  EETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSW
  TDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKD
  HPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNR
  SLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRR
  CGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV

• Structural information:
  • Protein Domains: Link. (32-120)
  • Interpro: IPR016186  IPR001231  IPR016187  IPR000538  
  • Prosite: PS01241 PS50963
  • PDB: 1POZ 1UUH 2I83 4PZ3 4PZ4
  • PDBsum: 1POZ 1UUH 2I83 4PZ3 4PZ4
  • DIP: 1121
  • STRING: ENSP00000398632
• Other Databases: GeneCards:  CD44  Malacards:  CD44

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	NAS	molecular function
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0005540	hyaluronic acid binding	NAS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007160	cell-matrix adhesion	NAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016337	single organismal cell-cell adhesion	NAS	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0030214	hyaluronan catabolic process	TAS	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IMP	biological process
GO:0035692	macrophage migration inhibitory factor receptor complex	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0051216	cartilage development	IEP	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070487	monocyte aggregation	IMP	biological process
GO:1900625	positive regulation of monocyte aggregation	IMP	biological process
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0004896	cytokine receptor activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	NAS	molecular function
GO:0005540	hyaluronic acid binding	IEA	molecular function
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0005540	hyaluronic acid binding	NAS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0007160	cell-matrix adhesion	NAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016337	single organismal cell-cell adhesion	NAS	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0030214	hyaluronan catabolic process	TAS	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IMP	biological process
GO:0035692	macrophage migration inhibitory factor receptor complex	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0051216	cartilage development	IEP	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070487	monocyte aggregation	IMP	biological process
GO:1900625	positive regulation of monocyte aggregation	IMP	biological process
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0004896	cytokine receptor activity	IDA	molecular function
GO:0004415	hyalurononglucosaminidase activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005518	collagen binding	NAS	molecular function
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0005540	hyaluronic acid binding	IDA	molecular function
GO:0005540	hyaluronic acid binding	NAS	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0007160	cell-matrix adhesion	NAS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0016337	single organismal cell-cell adhesion	NAS	biological process
GO:0022617	extracellular matrix disassembly	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0030214	hyaluronan catabolic process	TAS	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IDA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IMP	biological process
GO:0035692	macrophage migration inhibitory factor receptor complex	IDA	cellular component
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0043518	negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0051216	cartilage development	IEP	biological process
GO:0060333	interferon-gamma-mediated signaling pathway	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070487	monocyte aggregation	IMP	biological process
GO:1900625	positive regulation of monocyte aggregation	IMP	biological process
GO:1902166	negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	biological process
GO:0004896	cytokine receptor activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04512	ECM-receptor interaction
hsa04640	Hematopoietic cell lineage
hsa05206	MicroRNAs in cancer
hsa05205	Proteoglycans in cancer
hsa05131	Shigellosis
hsa05169	Epstein-Barr virus infection

Diseases

Associated diseases	References
Cancer (head and neck)	GAD: 20819778
Cancer (ovarian)	GAD: 20628624
Cancer (breast)	GAD: 20530438
Cancer (gastric)	KEGG: H00018
Congenital abnormalities	GAD: 20098615
Cleft defects	GAD: 16415175
Systemic lupus erythematosus (SLE)	GAD: 12215908
Arthritis	GAD: 11981324
Chronic renal failure	GAD: 21085059
Endometriosis	INFBASE: 23639674
Female infertility	INFBASE: 25711649
Ovarian endometrial cysts	INFBASE: 9647570
Ovarian endometriosis	INFBASE: 14556838
Polycystic ovary syndrome (PCOS)	INFBASE: 22007253
Unexplained infertility	INFBASE: 22007253
Endometriotic lesions	INFBASE: 11966474
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Female external genitalia	MIK: 9626144
Primary amenorrhea	MIK: 9626144
Lack of breast development	MIK: 9626144
Leydig cell hypoplasia	MIK: 9626653
Male pseudohermaphrotidism	MIK: 16433250
Leydig cell hypoplasia	MIK: 15472221
Male hypogonadism	MIK: 18508780
Female infertility	MIK: 18508780
Oligoamenorrhea	MIK: 9514160
Male pseudohermaphroditism	MIK: 7719343
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray