• Gene id: 9592

Gene Summary

• Gene Symbol: IER2   Gene   UCSC   Ensembl
• Aliases: ETR101
• Gene name: immediate early response 2
• Alternate names: immediate early response gene 2 protein, chxI protein homolog,
• Gene location: 19p13.13 (120450992: 120392292)     Exons: 10     NC_000003.12

Protein Summary

• Protein general information: Q9BTL4  
  • Name: Immediate early response gene 2 protein (Protein ETR101)
  • Length: 223  
  • Mass: 24196
  • Tissue specificity: Expressed in activated T-cells (at protein level) (PubMed
• Sequence:

  MEVQKEAQRIMTLSVWKMYHSRMQRGGLRLHRSLQLSLVMRSARELYLSAKVEALEPEVSLPAALPSDPRLHPPR
  EAESTAETATPDGEHPFPEPMDTQEAPTAEETSACCAPRPAKVSRKRRSSSLSDGGDAGLVPSKKARLEEKEEEE
  GASSEVADRLQPPPAQAEGAFPNLARVLQRRFSGLLNCSPAAPPTAPPACEAKPACRPADSMLNVLVRAVVAF

• Structural information:
  • Interpro: IPR008653  
  • STRING: ENSP00000465617
• Other Databases: GeneCards:  IER2  Malacards:  IER2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0048870	cell motility	IMP	biological process
GO:0071774	response to fibroblast growth factor	ISS	biological process
GO:0030182	neuron differentiation	ISS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Hypospadias	MIK: 24778562
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray
24778562	Hypospadias			13 (5 controls, 8 cases)	Male infertility	Microarray