• Gene id: 9589

Gene Summary

• Gene Symbol: WTAP   Gene   UCSC   Ensembl
• Aliases: Mum2
• Gene name: WT1 associated protein
• Alternate names: pre-mRNA-splicing regulator WTAP, PNAS-132, Wilms tumor 1 associated protein, Wilms' tumour 1-associating protein, female-lethal(2)D homolog, hFL(2)D, putative pre-mRNA splicing regulator female-lethal(2D), wilms tumor 1-associating protein,
• Gene location: 6q25.3 (10119898: 10115013)     Exons: 11     NC_000019.10
• Gene summary(Entrez): The Wilms tumor suppressor gene WT1 appears to play a role in both transcriptional and posttranscriptional regulation of certain cellular genes. This gene encodes a WT1-associating protein, which is a ubiquitously expressed nuclear protein. Like WT1 prote
• OMIM: 605442

Protein Summary

• Protein general information: Q15007  
  • Name: Pre mRNA splicing regulator WTAP (Female lethal(2)D homolog) (hFL(2)D) (WT1 associated protein) (Wilms tumor 1 associating protein)
  • Length: 396  
  • Mass: 44244
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MTNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENI
  LVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD
  SQTGKKLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDELNDFIIQLDEEVEGMQSTILVL
  QQQLKETRQQLAQYQQQQSQASAPSTSRTTASEPVEQSEATSKDCSRLTNGPSNGSSSRQRTSGSGFHREGNTTE
  DDFPSSPGNGNKSSNSSEERTGRGGSGYVNQLSAGYESVDSPTGSENSLTHQSNDTDSSHDPQEEKAVSGKGNRT
  VGSRHVQNGLDSSVNVQGSVL

• Structural information:
  • Interpro: IPR033757  IPR029732  
  • DIP: 57185
  • STRING: ENSP00000351141
• Other Databases: GeneCards:  WTAP  Malacards:  WTAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0080009	mRNA methylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0080009	mRNA methylation	IMP	biological process
GO:0080009	mRNA methylation	IMP	biological process
GO:0080009	mRNA methylation	IMP	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0080009	mRNA methylation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0016070	RNA metabolic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)