• Gene id: 9588

Gene Summary

• Gene Symbol: PRDX6   Gene   UCSC   Ensembl
• Aliases: 1-Cys, AOP2, HEL-S-128m, NSGPx, PRX, aiPLA2, p29
• Gene name: peroxiredoxin 6
• Alternate names: peroxiredoxin-6, 1-Cys PRX, 1-Cys peroxiredoxin, 24 kDa protein, acidic calcium-independent phospholipase A2, antioxidant protein 2, epididymis secretory sperm binding protein Li 128m, liver 2D page spot 40, non-selenium glutathione peroxidase, red blood cells pag,
• Gene location: 1q25.1 (17810941: 17844864)     Exons: 21     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain org
• OMIM: 602316

Protein Summary

• Protein general information: P30041  
  • Name: Peroxiredoxin 6 (EC 1.11.1.15) (1 Cys peroxiredoxin) (1 Cys PRX) (24 kDa protein) (Acidic calcium independent phospholipase A2) (aiPLA2) (EC 3.1.1.4) (Antioxidant protein 2) (Liver 2D page spot 40) (Non selenium glutathione peroxidase) (NSGPx) (Red blood
  • Length: 224  
  • Mass: 25035
• Sequence:

  MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDS
  VEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYP
  ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

• Structural information:
  • Protein Domains: (5..16-)
    (/note="Thioredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00691"-)
  • Interpro: IPR000866  IPR024706  IPR019479  IPR036249  IPR013766  
  • Prosite: PS51352
  • PDB: 1PRX 5B6M 5B6N
  • PDBsum: 1PRX 5B6M 5B6N
  • STRING: ENSP00000342026
• Other Databases: GeneCards:  PRDX6  Malacards:  PRDX6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0045454	cell redox homeostasis	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0051920	peroxiredoxin activity	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0004601	peroxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0016209	antioxidant activity	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0102567	phospholipase A2 activity (consuming 1,2-dipalmitoylphosphatidylcholine)	IEA	molecular function
GO:0102568	phospholipase A2 activity consuming 1,2-dioleoylphosphatidylethanolamine)	IEA	molecular function
GO:0004623	phospholipase A2 activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034599	cellular response to oxidative stress	TAS	biological process
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0004602	glutathione peroxidase activity	IEA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006979	response to oxidative stress	IMP	biological process
GO:0098869	cellular oxidant detoxification	IMP	biological process
GO:0004602	glutathione peroxidase activity	IMP	molecular function
GO:0046475	glycerophospholipid catabolic process	IMP	biological process
GO:0042802	identical protein binding	IMP	molecular function
GO:0047499	calcium-independent phospholipase A2 activity	IMP	molecular function
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0048026	positive regulation of mRNA splicing, via spliceosome	IGI	biological process
GO:0005829	cytosol	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881