• Gene id: 9584

Gene Summary

• Gene Symbol: RBM39   Gene   UCSC   Ensembl
• Aliases: CAPER, CAPERalpha, FSAP59, HCC1, RNPC2
• Gene name: RNA binding motif protein 39
• Alternate names: RNA-binding protein 39, CAPER alpha, RNA-binding region (RNP1, RRM) containing 2, coactivator of activating protein-1 and estrogen receptors, epididymis secretory sperm binding protein, functional spliceosome-associated protein 59, hepatocellular carcinoma prot,
• Gene location: 20q11.22 (35742335: 35701346)     Exons: 21     NC_000020.11
• Gene summary(Entrez): This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and a
• OMIM: 604739

Protein Summary

• Protein general information: Q14498  
  • Name: RNA binding protein 39 (CAPER alpha) (CAPERalpha) (Hepatocellular carcinoma protein 1) (RNA binding motif protein 39) (RNA binding region containing protein 2) (Splicing factor HCC1)
  • Length: 530  
  • Mass: 59380
  • Tissue specificity: Widely expressed. Highly expressed in pancreas, skeletal muscle, lung and brain (PubMed
• Sequence:

  MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRERKKSKSRERKRSR
  SKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEER
  DARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIV
  QASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD
  SECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAA
  QQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDV
  IEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLL
  VPSRR

• Structural information:
  • Protein Domains: (153..23-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (250..32-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (445..50-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR029123  IPR006509  IPR000504   IPR003954  
  • Prosite: PS50102
  • PDB: 2JRS 2MHN 4OO6 4OZ0 4OZ1 4YUD 6PAI 6Q0R 6Q0V 6Q0W 6SJ7 6UD7 6UE5
  • PDBsum: 2JRS 2MHN 4OO6 4OZ0 4OZ1 4YUD 6PAI 6Q0R 6Q0V 6Q0W 6SJ7 6UD7 6UE5
  • DIP: 32928
  • STRING: ENSP00000253363
• Other Databases: GeneCards:  RBM39  Malacards:  RBM39

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048024	regulation of mRNA splicing, via spliceosome	IDA	biological process
GO:0048024	regulation of mRNA splicing, via spliceosome	IMP	biological process
GO:0048024	regulation of mRNA splicing, via spliceosome	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006396	RNA processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016607	nuclear speck	IMP	cellular component
GO:0032991	protein-containing complex	IMP	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881