• Gene id: 9572

Gene Summary

• Gene Symbol: NR1D1   Gene   UCSC   Ensembl
• Aliases: EAR1, REVERBA, REVERBalpha, THRA1, THRAL, ear-1, hRev
• Gene name: nuclear receptor subfamily 1 group D member 1
• Alternate names: nuclear receptor subfamily 1 group D member 1, Rev-ErbAalpha, V-erbA-related protein 1, nuclear receptor Rev-ErbA-alpha, rev-erbA-alpha,
• Gene location: 17q21.1 (40100588: 40092792)     Exons: 8     NC_000017.11
• Gene summary(Entrez): This gene encodes a transcription factor that is a member of the nuclear receptor subfamily 1. The encoded protein is a ligand-sensitive transcription factor that negatively regulates the expression of core clock proteins. In particular this protein repre
• OMIM: 615256

Protein Summary

• Protein general information: P20393  
  • Name: Nuclear receptor subfamily 1 group D member 1 (Rev erbA alpha) (V erbA related protein 1) (EAR 1)
  • Length: 614  
  • Mass: 66805
  • Tissue specificity: Widely expressed. Expressed at high levels in the liver, adipose tissue, skeletal muscle and brain. Also expressed in endothelial cells (ECs), vascular smooth muscle cells (VSMCs) and macrophages. Expression oscillates diurnally in the
• Sequence:

  MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSL
  SDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVASGFHYGVHACE
  GCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMN
  LANNQLSSQCPLETSPTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
  TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQAPSSYPPTWPPGPAH
  HSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREV
  VEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSE
  KLNSLALTEEELGLFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
  MHSEKLLSFRVDAQ

• Structural information:
  • Protein Domains: (284..61-)
    (/note="NR-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"-)
  • Interpro: IPR035500  IPR000536  IPR001723  IPR001628  IPR013088  
  • Prosite: PS51843 PS00031 PS51030
  • PDB: 1A6Y 1EF6 1GA5 1HLZ 3N00
  • PDBsum: 1A6Y 1EF6 1GA5 1HLZ 3N00
  • DIP: 48396
  • STRING: ENSP00000246672
• Other Databases: GeneCards:  NR1D1  Malacards:  NR1D1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0004879	nuclear receptor activity	IBA	molecular function
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0008134	transcription factor binding	IBA	molecular function
GO:0044321	response to leptin	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0020037	heme binding	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001222	transcription corepressor binding	IDA	molecular function
GO:0061889	negative regulation of astrocyte activation	ISS	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0070859	positive regulation of bile acid biosynthetic process	ISS	biological process
GO:0061469	regulation of type B pancreatic cell proliferation	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0019216	regulation of lipid metabolic process	ISS	biological process
GO:0010498	proteasomal protein catabolic process	ISS	biological process
GO:0005978	glycogen biosynthetic process	ISS	biological process
GO:0031648	protein destabilization	ISS	biological process
GO:0071356	cellular response to tumor necrosis factor	ISS	biological process
GO:0042749	regulation of circadian sleep/wake cycle	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	ISS	biological process
GO:0060086	circadian temperature homeostasis	ISS	biological process
GO:0045598	regulation of fat cell differentiation	ISS	biological process
GO:0044321	response to leptin	ISS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0001678	cellular glucose homeostasis	IMP	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001222	transcription corepressor binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071347	cellular response to interleukin-1	ISS	biological process
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:1903979	negative regulation of microglial cell activation	ISS	biological process
GO:0150079	negative regulation of neuroinflammatory response	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003707	steroid hormone receptor activity	TAS	molecular function
GO:0004879	nuclear receptor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0007623	circadian rhythm	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0070859	positive regulation of bile acid biosynthetic process	IEA	biological process
GO:0061889	negative regulation of astrocyte activation	IEA	biological process
GO:0061469	regulation of type B pancreatic cell proliferation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0031648	protein destabilization	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0010498	proteasomal protein catabolic process	IEA	biological process
GO:0005978	glycogen biosynthetic process	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:1903979	negative regulation of microglial cell activation	IEA	biological process
GO:0150079	negative regulation of neuroinflammatory response	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0070888	E-box binding	IEA	molecular function
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0060086	circadian temperature homeostasis	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0044321	response to leptin	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0042749	regulation of circadian sleep/wake cycle	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0042632	cholesterol homeostasis	IDA	NOT|biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0010871	negative regulation of receptor biosynthetic process	IMP	biological process
GO:0034144	negative regulation of toll-like receptor 4 signaling pathway	IMP	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0004879	nuclear receptor activity	IBA	molecular function
GO:0009755	hormone-mediated signaling pathway	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0090575	RNA polymerase II transcription regulator complex	IBA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0008134	transcription factor binding	IBA	molecular function
GO:0044321	response to leptin	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0020037	heme binding	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001222	transcription corepressor binding	IDA	molecular function
GO:0061889	negative regulation of astrocyte activation	ISS	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0042632	cholesterol homeostasis	ISS	biological process
GO:0070859	positive regulation of bile acid biosynthetic process	ISS	biological process
GO:0061469	regulation of type B pancreatic cell proliferation	ISS	biological process
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0030425	dendrite	ISS	cellular component
GO:0019216	regulation of lipid metabolic process	ISS	biological process
GO:0010498	proteasomal protein catabolic process	ISS	biological process
GO:0005978	glycogen biosynthetic process	ISS	biological process
GO:0031648	protein destabilization	ISS	biological process
GO:0071356	cellular response to tumor necrosis factor	ISS	biological process
GO:0042749	regulation of circadian sleep/wake cycle	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	ISS	biological process
GO:0060086	circadian temperature homeostasis	ISS	biological process
GO:0045598	regulation of fat cell differentiation	ISS	biological process
GO:0044321	response to leptin	ISS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0042752	regulation of circadian rhythm	ISS	biological process
GO:0001678	cellular glucose homeostasis	IMP	biological process
GO:0032922	circadian regulation of gene expression	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001222	transcription corepressor binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071347	cellular response to interleukin-1	ISS	biological process
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:1903979	negative regulation of microglial cell activation	ISS	biological process
GO:0150079	negative regulation of neuroinflammatory response	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0048511	rhythmic process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003707	steroid hormone receptor activity	TAS	molecular function
GO:0004879	nuclear receptor activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0007623	circadian rhythm	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071356	cellular response to tumor necrosis factor	IEA	biological process
GO:0070859	positive regulation of bile acid biosynthetic process	IEA	biological process
GO:0061889	negative regulation of astrocyte activation	IEA	biological process
GO:0061469	regulation of type B pancreatic cell proliferation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0031648	protein destabilization	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0019216	regulation of lipid metabolic process	IEA	biological process
GO:0010498	proteasomal protein catabolic process	IEA	biological process
GO:0005978	glycogen biosynthetic process	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:1903979	negative regulation of microglial cell activation	IEA	biological process
GO:0150079	negative regulation of neuroinflammatory response	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0070888	E-box binding	IEA	molecular function
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0060086	circadian temperature homeostasis	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0045598	regulation of fat cell differentiation	IEA	biological process
GO:0044321	response to leptin	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0042752	regulation of circadian rhythm	IEA	biological process
GO:0042749	regulation of circadian sleep/wake cycle	IEA	biological process
GO:0032922	circadian regulation of gene expression	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0042632	cholesterol homeostasis	IDA	NOT|biological process
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IMP	biological process
GO:0010871	negative regulation of receptor biosynthetic process	IMP	biological process
GO:0034144	negative regulation of toll-like receptor 4 signaling pathway	IMP	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04710	Circadian rhythm

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq