• Gene id: 9564

Gene Summary

• Gene Symbol: BCAR1   Gene   UCSC   Ensembl
• Aliases: CAS, CAS1, CASS1, CRKAS, P130Cas
• Gene name: BCAR1 scaffold protein, Cas family member
• Alternate names: breast cancer anti-estrogen resistance protein 1, BCAR1, Cas family scaffold protein, BCAR1, Cas family scaffolding protein, Cas scaffolding protein family member 1, Crk-associated substrate p130Cas,
• Gene location: 16q23.1 (90858038: 90738692)     Exons: 5     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the Crk-associated substrate (CAS) family of scaffold proteins, characterized by the presence of multiple protein-protein interaction domains and many serine and tyrosine phosphorylation sites. The encoded p
• OMIM: 602941

Protein Summary

• Protein general information: P56945  
  • Name: Breast cancer anti estrogen resistance protein 1 (CRK associated substrate) (Cas scaffolding protein family member 1) (p130cas)
  • Length: 870  
  • Mass: 93372
  • Tissue specificity: Widely expressed with an abundant expression in the testis. Low level of expression seen in the liver, thymus, and peripheral blood leukocytes. The protein has been detected in a B-cell line.
• Sequence:

  MNHLNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRLKILVGMYDKKPAGPG
  PGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTPSKAQQGLYQVPGPSPQFQSPPAKQTSTFSK
  QTPHHPFPSPATDLYQVPPGPGGPAQDIYQVPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYE
  AAQPEQDEYDIPRHLLAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPS
  NHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAEDVYDVPPPAPDLYDVP
  PGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREAPAEGKRLSASSTGSTRSSQSASSLEVAGPG
  REPLELEVAVEALARLQQGVSATVAHLLDLAGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSA
  VGNAAHTSDRALHAKLSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGN
  ASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMEDYDYVHLQGKEEF
  EKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQ
  CEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRG
  IVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAA

• Structural information:
  • Protein Domains: (3..6-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192"-)
  • Interpro: IPR028848  IPR035745  IPR021901  IPR037362  IPR014928   IPR038319  IPR036028  IPR001452  
  • Prosite: PS50002
  • CDD: cd12001
  • PDB: 1WYX 3T6G 5O2M 5O2P 5O2Q
  • PDBsum: 1WYX 3T6G 5O2M 5O2P 5O2Q
  • DIP: 33855
  • STRING: ENSP00000391669
• Other Databases: GeneCards:  BCAR1  Malacards:  BCAR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090527	actin filament reorganization	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005886	plasma membrane	IBA	colocalizes with
GO:0005737	cytoplasm	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0017124	SH3 domain binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0016477	cell migration	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0030027	lamellipodium	IEA	cellular component
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IMP	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	IMP	biological process
GO:0048012	hepatocyte growth factor receptor signaling pathway	IMP	biological process
GO:0005886	plasma membrane	IDA	colocalizes with
GO:0005925	focal adhesion	IDA	cellular component
GO:0060326	cell chemotaxis	IMP	biological process
GO:0030424	axon	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0086100	endothelin receptor signaling pathway	IDA	biological process
GO:0016477	cell migration	IDA	biological process
GO:0001726	ruffle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0050853	B cell receptor signaling pathway	IDA	biological process
GO:0050851	antigen receptor-mediated signaling pathway	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0007015	actin filament organization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048011	neurotrophin TRK receptor signaling pathway	ISS	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	NAS	biological process
GO:0007186	G protein-coupled receptor signaling pathway	ISS	biological process
GO:0005925	focal adhesion	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050852	T cell receptor signaling pathway	NAS	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0007173	epidermal growth factor receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051301	cell division	NAS	biological process
GO:0008286	insulin receptor signaling pathway	ISS	biological process
GO:0001558	regulation of cell growth	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05135	Yersinia infection
hsa04670	Leukocyte transendothelial migration
hsa04935	Growth hormone synthesis, secretion and action
hsa05100	Bacterial invasion of epithelial cells
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Breast cancer	PMID:15448007
breast ductal carcinoma	PMID:11605729
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq