• Gene id: 956

Gene Summary

• Gene Symbol: ENTPD3   Gene   UCSC   Ensembl
• Aliases: CD39L3, HB6, NTPDase-3
• Gene name: ectonucleoside triphosphate diphosphohydrolase 3
• Alternate names: ectonucleoside triphosphate diphosphohydrolase 3, CD39 antigen-like 3, NTPDase 3, ecto-ATP diphosphohydrolase 3, ecto-ATPDase 3, ecto-ATPase 3, ecto-apyrase 3,
• Gene location: 3p22.1 (40387181: 40428743)     Exons: 13     NC_000003.12
• Gene summary(Entrez): This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been des

Protein Summary

• Protein general information: O75355  
  • Name: Ectonucleoside triphosphate diphosphohydrolase 3 (NTPDase 3) (EC 3.6.1.5) (CD39 antigen like 3) (Ecto ATP diphosphohydrolase 3) (Ecto ATPDase 3) (Ecto ATPase 3) (Ecto apyrase 3) (HB6)
  • Length: 529  
  • Mass: 59105
  • Tissue specificity: Expressed in adult brain, pancreas, spleen and prostate. Moderate or low expression is seen in most tissues. Not expressed in liver and peripheral blood leukocytes.
• Sequence:

  MFTVLTRQPCEQAGLKALYRTPTIIALVVLLVSIVVLVSITVIQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQW
  PAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNE
  TAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGAST
  QISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTM
  GHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYY
  TASALNLSGSFSLDTFNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTEETWPQIHFEK
  EVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPPVFVGTLAFFTAAALLCLAFLAYLCSATRRKRHSEHAFDHA
  VDSD

• Structural information:
  • Interpro: IPR000407  
  • Prosite: PS01238
  • STRING: ENSP00000301825
• Other Databases: GeneCards:  ENTPD3  Malacards:  ENTPD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0102486	dCTP phosphohydrolase activity	IEA	molecular function
GO:0102491	dGTP phosphohydrolase activity	IEA	molecular function
GO:0102490	8-oxo-dGTP phosphohydrolase activity	IEA	molecular function
GO:0102485	dATP phosphohydrolase activity	IEA	molecular function
GO:0102489	GTP phosphohydrolase activity	IEA	molecular function
GO:0102488	dTTP phosphohydrolase activity	IEA	molecular function
GO:0102487	dUTP phosphohydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034656	nucleobase-containing small molecule catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0009134	nucleoside diphosphate catabolic process	IEA	biological process
GO:0017110	nucleoside-diphosphatase activity	IEA	molecular function
GO:0017111	nucleoside-triphosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0009143	nucleoside triphosphate catabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05169	Epstein-Barr virus infection
hsa00230	Purine metabolism
hsa00240	Pyrimidine metabolism

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray