• Gene id: 9559

Gene Summary

• Gene Symbol: VPS26A   Gene   UCSC   Ensembl
• Aliases: HB58, Hbeta58, PEP8A, VPS26
• Gene name: VPS26, retromer complex component A
• Alternate names: vacuolar protein sorting-associated protein 26A, VPS26 retromer complex comonent A, vacuolar protein sorting 26 homolog A, vesicle protein sorting 26A,
• Gene location: 10q22.1 (44775539: 44778778)     Exons: 6     NC_000001.11
• Gene summary(Entrez): This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. Th
• OMIM: 605506

Protein Summary

• Protein general information: O75436  
  • Name: Vacuolar protein sorting associated protein 26A (Vesicle protein sorting 26A) (hVPS26)
  • Length: 327  
  • Mass: 38170
• Sequence:

  MSFLGGFFGPICEIDIVLNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQ
  IELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLI
  VHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTT
  ETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPE
  KLRKQRTNFHQRFESPESQASAEQPEM

• Structural information:
  • Interpro: IPR014752  IPR028934  
  • PDB: 2FAU 5F0J 5F0L 5F0M 5F0P
  • PDBsum: 2FAU 5F0J 5F0L 5F0M 5F0P
  • DIP: 29075
  • STRING: ENSP00000362480
• Other Databases: GeneCards:  VPS26A  Malacards:  VPS26A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010008	endosome membrane	IDA	cellular component
GO:0030904	retromer complex	IDA	cellular component
GO:0030906	retromer, cargo-selective complex	IDA	cellular component
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0030904	retromer complex	NAS	cellular component
GO:0030906	retromer, cargo-selective complex	NAS	cellular component
GO:0042147	retrograde transport, endosome to Golgi	NAS	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0030904	retromer complex	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0005768	endosome	IBA	cellular component
GO:0097422	tubular endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0030904	retromer complex	IDA	cellular component
GO:1990126	retrograde transport, endosome to plasma membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005769	early endosome	IEA	cellular component
GO:0030904	retromer complex	IEA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0030904	retromer complex	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005768	endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042147	retrograde transport, endosome to Golgi	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881