• Gene id: 9556

Gene Summary

• Gene Symbol: ATP5MPL   Gene   UCSC   Ensembl
• Aliases: 6.8PL, C14orf2, MLQ, MP68, PLPM
• Gene name: ATP synthase membrane subunit 6.8PL
• Alternate names: ATP synthase subunit ATP5MPL, mitochondrial, 6.8 kDa mitochondrial proteolipid, 6.8 kDa mitochondrial proteolipid protein, 6.8-kDa proteolipid with N-terminal sequence Met-Leu-Gln (MLQ),
• Gene location: 14q32.33 (103921528: 103912287)     Exons: 5     NC_000014.9
• OMIM: 604573

Protein Summary

• Protein general information: P56378  
  • Name: ATP synthase subunit ATP5MPL, mitochondrial (6.8 kDa mitochondrial proteolipid protein) (MLQ) (ATP synthase membrane subunit 6.8PL)
  • Length: 58  
  • Mass: 6662
• Sequence:

  MLQSIIKNIWIPMKPYYTKVYQEIWIGMGLMGFIVYKIRAADKRSKALKASAPAPGHH

• Structural information:
  • Interpro: IPR012574  
  • STRING: ENSP00000401770
• Other Databases: GeneCards:  ATP5MPL  Malacards:  ATP5MPL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005753	mitochondrial proton-transporting ATP synthase complex	IBA	cellular component
GO:0005753	mitochondrial proton-transporting ATP synthase complex	ISS	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005575	cellular_component	ND	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)