• Gene id: 9551

Gene Summary

• Gene Symbol: ATP5MF   Gene   UCSC   Ensembl
• Aliases: ATP5J2, ATP5JL
• Gene name: ATP synthase membrane subunit f
• Alternate names: ATP synthase subunit f, mitochondrial, ATP synthase f chain, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, ATP synthase, H+ transporting, mitochondrial Fo complex subunit F2, F1F0-type ATPase subunit f, F1Fo-ATP synthase co,
• Gene location: 7q22.1 (99466166: 99458157)     Exons: 5     NC_000007.14
• Gene summary(Entrez): Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the

Protein Summary

• Protein general information: P56134  
  • Name: ATP synthase subunit f, mitochondrial (ATP synthase membrane subunit f)
  • Length: 94  
  • Mass: 10918
• Sequence:

  MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVL
  FSYSFSYKHLKHERLRKYH

• Structural information:
  • Interpro: IPR019344  
  • STRING: ENSP00000292475
• Other Databases: GeneCards:  ATP5MF  Malacards:  ATP5MF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006754	ATP biosynthetic process	IEA	biological process
GO:0045263	proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0042407	cristae formation	TAS	biological process
GO:0006754	ATP biosynthetic process	TAS	biological process
GO:0006754	ATP biosynthetic process	TAS	biological process
GO:0042776	mitochondrial ATP synthesis coupled proton transport	TAS	biological process
GO:0046034	ATP metabolic process	IEA	biological process
GO:0005753	mitochondrial proton-transporting ATP synthase complex	IEA	cellular component
GO:0000276	mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005753	mitochondrial proton-transporting ATP synthase complex	IDA	cellular component
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism	IDA	contributes to
GO:0042776	mitochondrial ATP synthesis coupled proton transport	IDA	biological process
GO:0005634	nucleus	HDA	cellular component
GO:1902600	proton transmembrane transport	NAS	biological process
GO:0005753	mitochondrial proton-transporting ATP synthase complex	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq