• Gene id: 9547

Gene Summary

• Gene Symbol: CXCL14   Gene   UCSC   Ensembl
• Aliases: BMAC, BRAK, KEC, KS1, MIP-2g, MIP2G, NJAC, SCYB14
• Gene name: C-X-C motif chemokine ligand 14
• Alternate names: C-X-C motif chemokine 14, CXC chemokine in breast and kidney, MIP-2 gamma, bolekine, breast and kidney, chemokine (C-X-C motif) ligand 14, chemokine BRAK, small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK), small-inducible cytokine B14, tumor-suppr,
• Gene location: 5q31.1 (135578990: 135570678)     Exons: 4     NC_000005.10
• Gene summary(Entrez): This antimicrobial gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Mem
• OMIM: 191092

Protein Summary

• Protein general information: O95715  
  • Name: C X C motif chemokine 14 (Chemokine BRAK) (MIP 2G) (Small inducible cytokine B14)
  • Length: 111  
  • Mass: 13078
  • Tissue specificity: Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derive
• Sequence:

  MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSV
  SRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

• Structural information:
  • Interpro: IPR001811  IPR039088  IPR036048  
  • PDB: 2HDL
  • PDBsum: 2HDL
  • DIP: 61148
  • STRING: ENSP00000337065
• Other Databases: GeneCards:  CXCL14  Malacards:  CXCL14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061844	antimicrobial humoral immune response mediated by antimicrobial peptide	IBA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008009	chemokine activity	IEA	molecular function
GO:0006955	immune response	IEA	biological process
GO:0060326	cell chemotaxis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0008009	chemokine activity	TAS	molecular function
GO:0006935	chemotaxis	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0007267	cell-cell signaling	TAS	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045662	negative regulation of myoblast differentiation	IEA	biological process
GO:0048839	inner ear development	IEA	biological process
GO:2000503	positive regulation of natural killer cell chemotaxis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04062	Chemokine signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881