• Gene id: 9542

Gene Summary

• Gene Symbol: NRG2   Gene   UCSC   Ensembl
• Aliases: DON1, HRG2, NTAK
• Gene name: neuregulin 2
• Alternate names: pro-neuregulin-2, membrane-bound isoform, divergent of neuregulin-1, neural- and thymus-derived activator for ErbB kinases, pro-NRG2,
• Gene location: 5q31.2 (140043674: 139846778)     Exons: 15     NC_000005.10
• Gene summary(Entrez): This gene encodes a novel member of the neuregulin family of growth and differentiation factors. Through interaction with the ERBB family of receptors, this protein induces the growth and differentiation of epithelial, neuronal, glial, and other types of
• OMIM: 603818

Protein Summary

• Protein general information: O14511  
  • Name: Pro neuregulin 2, membrane bound isoform (Pro NRG2) [Cleaved into: Neuregulin 2 (NRG 2) (Divergent of neuregulin 1) (DON 1) (Neural and thymus derived activator for ERBB kinases) (NTAK)]
  • Length: 850  
  • Mass: 91679
  • Tissue specificity: Restricted to the cerebellum in the adult.
• Sequence:

  MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSSESGSSSRSSSNNSSISRPAAPPEPRPQQQPQPRS
  PAARRAAARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTR
  EPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEV
  GKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNK
  VKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNG
  FFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRKQMHNHLRQNMCPAHQ
  NRSLANGPSHPRLDPEEIQMADYISKNVPATDHVIRRETETTFSGSHSCSPSHHCSTATPTSSHRHESHTWSLER
  SESLTSDSQSGIMLSSVGTSKCNSPACVEARARRAAAYNLEERRRATAPPYHDSVDSLRDSPHSERYVSALTTPA
  RLSPVDFHYSLATQVPTFEITSPNSAHAVSLPPAAPISYRLAEQQPLLRHPAPPGPGPGPGPGPGPGADMQRSYD
  SYYYPAAGPGPRRGTCALGGSLGSLPASPFRIPEDDEYETTQECAPPPPPRPRARGASRRTSAGPRRWRRSRLNG
  LAAQRARAARDSLSLSSGSGGGSASASDDDADDADGALAAESTPFLGLRGAHDALRSDSPPLCPAADSRTYYSLD
  SHSTRASSRHSRGPPPRAKQDSAPL

• Structural information:
  • Protein Domains: (237..33-)
    (/note="Ig-like-C2-type)
    (341..38-)
    (/note="EGF-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076"-)
  • Interpro: IPR013032  IPR000742  IPR007110  IPR036179  IPR013783   IPR013098  IPR003599  IPR003598  IPR040180  IPR002154  
  • Prosite: PS00022 PS01186 PS50026 PS50835
  • STRING: ENSP00000354910
• Other Databases: GeneCards:  NRG2  Malacards:  NRG2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048513	animal organ development	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0007399	nervous system development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005102	signaling receptor binding	TAS	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:2000145	regulation of cell motility	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04012	ErbB signaling pathway
hsa01521	EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq