• Gene id: 9540

Gene Summary

• Gene Symbol: TP53I3   Gene   UCSC   Ensembl
• Aliases: PIG3
• Gene name: tumor protein p53 inducible protein 3
• Alternate names: quinone oxidoreductase PIG3, p53-induced gene 3 protein, quinone oxidoreductase homolog,
• Gene location: 2p23.3 (24539565: 24572862)     Exons: 18     NC_000016.10
• Gene summary(Entrez): The protein encoded by this gene is similar to oxidoreductases, which are enzymes involved in cellular responses to oxidative stresses and irradiation. This gene is induced by the tumor suppressor p53 and is thought to be involved in p53-mediated cell dea
• OMIM: 605171

Protein Summary

• Protein general information: Q53FA7  
  • Name: Quinone oxidoreductase PIG3 (EC 1. . . ) (Tumor protein p53 inducible protein 3) (p53 induced gene 3 protein)
  • Length: 332  
  • Mass: 35536
• Sequence:

  MLAVHFDKPGGPENLYVKEVAKPSPGEGEVLLKVAASALNRADLMQRQGQYDPPPGASNILGLEASGHVAELGPG
  CQGHWKIGDTAMALLPGGGQAQYVTVPEGLLMPIPEGLTLTQAAAIPEAWLTAFQLLHLVGNVQAGDYVLIHAGL
  SGVGTAAIQLTRMAGAIPLVTAGSQKKLQMAEKLGAAAGFNYKKEDFSEATLKFTKGAGVNLILDCIGGSYWEKN
  VNCLALDGRWVLYGLMGGGDINGPLFSKLLFKRGSLITSLLRSRDNKYKQMLVNAFTEQILPHFSTEGPQRLLPV
  LDRIYPVTEIQEAHKYMEANKNIGKIVLELPQ

• Structural information:
  • Interpro: IPR013149  IPR013154  IPR011032  IPR036291  IPR020843   IPR014189  
  • CDD: cd05276
  • PDB: 2J8Z 2OBY
  • PDBsum: 2J8Z 2OBY
  • STRING: ENSP00000238721
• Other Databases: GeneCards:  TP53I3  Malacards:  TP53I3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048038	quinone binding	IBA	molecular function
GO:0003960	NADPH:quinone reductase activity	IBA	molecular function
GO:0070402	NADPH binding	IBA	molecular function
GO:0048038	quinone binding	IDA	molecular function
GO:0006739	NADP metabolic process	IDA	biological process
GO:0003960	NADPH:quinone reductase activity	IDA	molecular function
GO:0070402	NADPH binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray