• Gene id: 9538

Gene Summary

• Gene Symbol: EI24   Gene   UCSC   Ensembl
• Aliases: EPG4, PIG8, TP53I8
• Gene name: EI24 autophagy associated transmembrane protein
• Alternate names: etoposide-induced protein 2.4 homolog, ectopic P-granules autophagy protein 4 homolog, etoposide induced 2.4, p53-induced gene 8 protein, tumor protein p53 inducible protein 8,
• Gene location: 11q24.2 (125569215: 125584683)     Exons: 13     NC_000011.10
• Gene summary(Entrez): This gene encodes a putative tumor suppressor and has higher expression in p53-expressing cells than in control cells and is an immediate-early induction target of p53-mediated apoptosis. The encoded protein may suppress cell growth by inducing apoptotic
• OMIM: 605170

Protein Summary

• Protein general information: O14681  
  • Name: Etoposide induced protein 2.4 homolog (p53 induced gene 8 protein)
  • Length: 340  
  • Mass: 38965
• Sequence:

  MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERKQESEPRIVSRIFQCC
  AWNGGVFWFSLLLFYRVFIPVLQSVTARIIGDPSLHGDVWSWLEFFLTSIFSALWVLPLFVLSKVVNAIWFQDIA
  DLAFEVSGRKPHPFPSVSKIIADMLFNLLLQALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKG
  IEMHQRLSNIERNWPYYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFL
  SNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKATAGH

• Structural information:
  • Interpro: IPR009890  
  • STRING: ENSP00000278903
• Other Databases: GeneCards:  EI24  Malacards:  EI24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016236	macroautophagy	IBA	biological process
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0006915	apoptotic process	TAS	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04115	p53 signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)