• Gene id: 9537

Gene Summary

• Gene Symbol: TP53I11   Gene   UCSC   Ensembl
• Aliases: PIG11
• Gene name: tumor protein p53 inducible protein 11
• Alternate names: tumor protein p53-inducible protein 11, p53-induced gene 11 protein,
• Gene location: 11p11.2 (44951305: 44932347)     Exons: 13     NC_000011.10
• OMIM: 617867

Protein Summary

• Protein general information: O14683  
  • Name: Tumor protein p53 inducible protein 11 (p53 induced gene 11 protein)
  • Length: 189  
  • Mass: 21054
• Sequence:

  MAAKQPPPLMKKHSQTDLVSRLKTRKILGVGGEDDDGEVHRSKISQVLGNEIKFTIREPLGLRVWQFVSAVLFSG
  IAIMALAFPDQLYDAVFDGAQVTSKTPIRLYGGALLSISLIMWNALYTAEKVIIRWTLLTEACYFGVQFLVVTAT
  LAETGLMSLGILLLLVSRLLFVVISIYYYYQVGRRPKKA

• Structural information:
  • Interpro: IPR028266  
  • STRING: ENSP00000436152
• Other Databases: GeneCards:  TP53I11  Malacards:  TP53I11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq